[image]HomeLatestTechnologyAIStartupsMobileBusinessAutoEducationAudit Report Exposes Zong’s Spectrum Misuse Worth Rs53.5 BillionJazz Faces Scrutiny Over Rs 6.58 Billion Consumer OverchargingPakistani Youngster Builds ‘Safar’ Metrobus Routes App Alone, Free for EveryonePTCL Internet Faces Nationwide Outage, Other ISPs Also AffectedPunjab Govt Increases Vehicle Registration & Transfer Fees Effective September 1FinanceECC Greenlights Rs3.5bn to Boost Raast QR AdoptionSECP Moves to Make Capital Market More Accessible for Retail InvestorsSocial MediaMeta AI Adds Real-Time Dubbing to Reels on Instagram, FacebookOpenAI Speeds Up GPT-6 with Memory-Powered AI AssistantSpotify Adds Option to Build Your Own Playlist TransitionsDevicesGoogle Pixel 10 Series US Prices Leak, Covering All Storage VariantsGoogle Pays $30M in YouTube Child Privacy ScandalShow allPakistan Activates 911 Emergency Helpline Amid Flood CrisisOpenAI Leak Reveals ChatGPT Agent May Soon Control Your BrowserAndroid NFC Malware ‘PhantomCard’ Hijacks Contactless Payments, Banks WarnNCERT Issues Advisory on Blue Locker Ransomware ThreatElon Musk Warns “OpenAI Will Eat Microsoft Alive” as GPT-5 LaunchesHackers Paralyze PPL IT Systems, Suspend Operations for DaysEarthquakes Act Like Batteries to Power Life Deep Underground, Study FindsUnilever Pakistan H1 Sales Rise 15% While Profit SlipsHEC Laptop Procurement Audit Reveals Rs130 Million LossLogiserve Gains NBFC License to Power Fintech for MerchantsRumor Suggests iPhone 17 Might End the Camera Control Button EraApple Might Break Traditional Launch Cycle with iPhone 18 SeriesRealme 15T Spotted with Latest Chipset Details LeakedApple iPhone 17e Leak Unveils New DetailsCourt Extends Custody of YouTuber Ducky Bhai Until August 23New TikTok “Campus Verification” Feature Helps Students Find ClassmatesNew Aeolus L8 EV Covers Karachi–Islamabad Without RefillTraffic Challans in Punjab to Be Received Directly on WhatsAppChinese Firm to Build EV Manufacturing Facility in PunjabImage Source: Business RecorderHigher Duties Threaten Pakistan Electric Bike Scheme and PricesHas BISE Lahore Decided to End Hard Copy Result Mark Sheets?All BISE Punjab Boards Class 9 Result 2025 AnnouncedFBISE Officially Releases SSC 9th and 10th Class Date Sheet 2025CAIE O Level Results 2025 ReleasedSindh Announces One-Year Free ECCE Diploma for Female TeachersMIT’s Boltz-2 AI Model Revolutionizes Drug Discovery with 1,000× SpeedGoogle Ads Ends Manual Language Targeting in Search Campaigns, Adopts AIGoogle Docs Now Reads Your Work Aloud with Gemini AIPakistan Launches Uraan AI Techathon to Boost InnovationGuidesA Complete Guide on Getting a Faysal Bank Noor Credit Card (2025)How To Get an Allied Bank Limited Credit Card (2025)?The 2025 Guide to Getting and Using Your Sindh Bank Debit CardHow to Instantly Get a Bank of Khyber Digital Debit Card in 2025NewsTelecomCryptocurrencyPrice PortalCurrency ConverterUSD to PKRBTC to PKRAbout UsContact UsPrivacy PolicyEthicsGet AlertsETH to PKRAED to PKREUR to PKRAboutContactEducationImage Source: AppleInsiderSalman AkhtarHow to Import Old Passwords into Apple Passwords on MacYango Group Enters Pakistan’s Startup Scene with Trukkr InvestmentPakistani Startup Myco Wins PKR 420M on Tim Draper’s ShowBusCaro Secures Major Funding from Accelerate ProsperityHow to's# top# slider# News# Pakistan# Pakistani Startups# Entrepreneurs# press release# Startup# Careem# UberPakistan’s First Govt-Backed Makerspace Set to Launch in LahoreManik AftabPakistani Startup in Saudi Arabia Eyes $20 Million with New DealsPakistani Startup Beats Global Competition in 102-Country Agrifood ChallengeZohaib ShahShark Tank Pakistan Funding Faces Reality Check as Only 4 of 36 Deals MaterializeHow a Software Engineer in India Pulled Off Multiple Jobs All at once— Until He Got Caught27 Startups Join National Incubation Center Lahore Cohort 2Neem Paymenow Gets Rs100 Million from HBL to Scale Earned Wage AccessWix Drops $80M to Acquire a Solo AI Startup—Here’s What They’re PlanningPakistan-Based Allia Health Grabs $2M for Better Mental HealthcareAbdul WasayPak-American Entrepreneur Raises $600M for AI Vehicle Startup Applied IntuitionKodifly Selected for ScaleX Program to Expand in Saudi ArabiaK-Electric EPIC 2025 Awards Top Energy Startups in PakistanUK Startup Offers £35,000 in Grants for Pakistani Entrepreneurs23119→Image Source: AppleInsiderPakistan-Based Allia Health Grabs $2M for Better Mental HealthcarePTCL Audit Reveals Rs624 Million Loss Over Project DelaysPTCL Project in Quetta Under Scrutiny After Audit FindingsSenate Panel Seeks PTA Answer on Jazz ‘Overbilling’ PracticesCybersecurityHackers Leak Egyptian Minister’s Private Video To Stop $35B Gas Deal with IsraelAGP Flags Rs 9.15 Billion Misuse of Ignite R&D Funds In Governance GapsFeaturedUS Mobile Story: Ahmed Khattak’s $200M Growth in 9 MonthsMeta AI Reorganization Reshapes Superintelligence TeamsFintechState Bank Declares 1LINK a Designated Payment System‘Eyes of the City’ Stolen: Rawalpindi’s Safe City Cameras Disappear OvernightChinese DeepSeek Rolls Out V3.1 With New Features, Affordable AccessPakistan-Qatar LNG Deal Likely to Be RenegotiatedPunjab Govt Reinstates Old Pension Rules for Widows and DaughtersPakistani YouTuber Rajab Butt Could Soon Be on Interpol’s Wanted List: Here’s Why!‘It’s Time to Stop Treating AI Like Humans,’ Microsoft AI Chief UrgesSabica TahiraCarsLahore Transport Fares Cut by 5% After Diesel Price DropGovt Announces Auto Sector Tariff Reduction PlanGovt Weighs Changes in Used Car Import PolicyBikesFemale Teachers in Sialkot to Receive Free E-Bikes# Electric Vehicles# Electric Vehicle# Toyota# Honda# Suzuki# BYD# KIA# Tesla# Sindh Government# Punjab GovernmentElon Musk Provides Key Update on Upcoming Tesla FeatureHonda Hybrid Car Launch Confirmed for PakistanAuto Sales Plunge 49% After Pre-Budget Rush in JuneHaval Sales Slide as New Entrants Heat Up CompetitionNew Modern Railway Station Set to Open in Major CityBYD Shark 6 Limited-Time Promotion Announced in PakistanPakistan and China Target Lithium-Ion Batteries Replacement for Future EVsHonda CD70 2025 Launched with Cosmetic Changes Only33Haval Sales Slide as New Entrants Heat Up CompetitionPTCL Audit Reveals Rs624 Million Loss Over Project DelaysScientists Successfully Use Lab-Grown Brain to Control Robot Dogs‘It’s Time to Stop Treating AI Like Humans,’ Microsoft AI Chief UrgesCall of Duty: Black Ops 7 Unveiled, Here’s Everything You Need to KnowBitcoin Holds Steady Near $113K; Solana, Dogecoin Lead Gains1,920BISE Lahore Class 9 Result 2025 to Be Officially Announced. Date Confirmed!All BISE Punjab Boards Class 9 Result 2025 to Be Announced: Here’s WhenBISE Gujranwala Class 9th Result 2025 Is Set To Be Announced on This DateBISE Rawalpindi Class 9th Result 2025 to Be Announced! Here’s WhenBISE Sahiwal Class 9th Result 2025 to Be Published: Here’s WhenBISE Faisalabad Class 9th Result 2025 to Be Declared! Date ConfirmedRs100 Prize Bond Draw No. 51 in Lahore on August 2025, Results AnnouncedBISE Multan Class 9th Result 2025 to Be Officially Announced: Here’s WhenBISE Gujranwala Class 9 Result 2025 AnnouncedBISE D.G. Khan Class 9th Result 2025 to Be Announced! Date Revealed1500 Prize Bond Draw August 2025 Faisalabad: Results, Prizes AnnouncedBISE Bahawalpur Class 9th Result 2025 to Be Announced: Here’s WhenPTCL Audit Reveals Rs624 Million Loss Over Project DelaysData Protection Standards Issued to Safeguard CitizensPakistan’s NCCIA Cracks Down on Illegal Betting, Forex, Binary AppsSciencePakistan’s First Astronaut to Travel to Space in 2026GadgetsApple’s First 5G MacBook Pro (M5) Could Launch Early 2026A New Malware Tricks People Into Clicking on Fake ChatGPT Apps# Google# Apple# Microsoft# tech news# International# latest tech newsPakistan’s IT Exports Jump 24% in July 2025HTC Shares Soar as AI-Powered Vive Eagle Glasses Debut in TaiwanBreakthrough in Superconductors Pave Way for Next-Gen Quantum ComputersThis 19yo from Taxila Developed Car Control App That Uses Hand GesturesAndroid Users to Get Better Data Backup Support in Upcoming UpdateGoogle Telco Deals Cost $35.8 Million Fine in AustraliaTechJuice541Data Protection Standards Issued to Safeguard CitizensAndroid Users to Get Better Data Backup Support in Upcoming UpdateChatGPT Launches “ChatGPT Go” Under PKR 1500, But Not For EveryoneAnthropic’s Claude AI Ends Harmful Chats AutomaticallyGoogle Launches Flight Deals, an AI-Powered Search ToolMeta Engineers Divide AI Lab Yet Again to Chase SuperintelligenceChina Data Centres Shift to Local Chips as Tech War with US DeepensElon Musk Says His Grok Imagine Can Turn Back Time on Old Photos# OpenAI# AI# ChatGPT# Meta# AI Chatbots# DeepSeekSabica TahiraxAI Unveils New AI Chatbot Companions, And That May Be a ProblemAI-Powered Humanoid Robots Move Closer to Everyday Home UseChatGPT App Revenue Hits $2 Billion with $2.91 Per InstallChatGPT Launches “ChatGPT Go” Under PKR 1500, But Not For Everyone48Anthropic’s Claude AI Ends Harmful Chats AutomaticallyBISE DG Khan Class 9th Result 2025 AnnouncedBISE Multan Class 9th Result 2025 Declared# Education# HEC# LUMS# Matric Result 2025# NUSTBISE Rawalpindi Class 9th Result 2025 OutBISE Lahore Class 9 Result 2025 AnnouncedBISE Sahiwal Class 9th Result 2025 PublishedBISE Bahawalpur Class 9 Result 2025 DeclaredBISE Sargodha Class 9 Result 2025 AnnouncedBISE Faisalabad Class 9 Result 2025 DeclaredSindh Education Board Introduces New Subject Groups for Matric StudentsChina’s New K Visa Opens Doors for Pakistani GraduatesPunjab CM Internship Program Opens for Veterinary Graduates71BISE DG Khan Class 9th Result 2025 AnnouncedBISE Faisalabad Class 9 Result 2025 DeclaredVivo X Fold5Realme GT 7 Dream AdditionTecno Spark Go 2Tecno Spark 40 Pro+Tecno Spark 40 ProInfinix Hot 60 ProTECNO SPARK 40 Series Now Available in Pakistan – Starting at PKR 48,999Samsung Galaxy S26 Pro Display, Battery Capacity LeaksiPhone 17 Pro Camera Specs and Design Tipped by dbrandXiaomi Redmi Note 15 Pro Series Official Launch Date ConfirmedApple Might Ditch iPhone 18 in 2026, Reports Suggest# Samsung# Mobile# Smartphones# Huawei# iPhoneVivo G3 Debuts with Massive 6,000mAh BatterySponsoredGoogle Reveals Pixel 10 Pro Fold Design in Official Video TeaserHonor Magic V Flip2 Launch Date and Full Design Details AnnouncedTECNO Reunites with Naseem Shah for Spark 40 Series LaunchVivo V60 Unveiled Featuring ZEISS Triple Cameras and Massive BatteryApple Expected to Launch $699 MacBook to Expand Laptop MarketVivo X Fold5 Arrives in Pakistan with Lightest Ever Foldable327Vivo G3 Debuts with Massive 6,000mAh BatteryEPBD Releases Wealth Perception Index 2025 Lists Featuring Pakistan’s Top 40 ConglomeratesFBR Imposes Cash Limit on COD Orders Across PakistanMinistry Demands Swift Raast QR Code Implementation for Utility BillsTaxationFBR Rolls Out Simplified Electronic Tax Return FormMobile Wallets Gain Momentum with Over 143M Broadband UsersPakistan to Introduce Digital IDs for Citizens in Cashless Economy PushPakistan’s Forex Reserves Rise to $19.5 Billion, SBP Reports $11 Million BoostPakistan Sets Up $1 Billion Panda Bond Program in China# SBP# FBR# State Bank of Pakistan (SBP)# Pakistan Economy# SECP# PSX# Pakistan Stock Exchange (PSX)# IMF# UBL# PIARing Road Economic Zones to Boost Rawalpindi Trade and JobsSystems Limited Posts Strong First Half Earnings GrowthKAPCO Attock Cement Acquisition Moves Forward with Binding OfferAmazon Appstore Shutting Down on Android DevicesPakistan Iran Agriculture Trade Target Set at $3 Billion in Two YearsT-Bills Lose Appeal as Foreign Investors Pull Out57Amazon Appstore Shutting Down on Android Devices[email protected]How to set-up a wordpress blog in 5 minutesRehan AhmedGoogle lets you keep a detailed track on Pakistani Olympic team’s progressThis site lists everything you can ask Siri to do for youInstagram copies Snapchat to introduce StoriesStartupList.pk is a crowd-sourced database of Pakistani startupsFIA proposes special tribunal, awareness campaigns for implementation of Cyber Crime lawHere’s how you can still get Windows 10 for free#GoGreenCampaign trending on twitter wants to show the positive side of PakistanSome Pakistanis believe Prisma is related to the IlluminatiPakistani-American’s speech spikes Google search for vote registrationThis map for the most Googled product in every country shows what Pakistanis search forPo-Khi-Mon Express is a bus tour for catching Pokemons in PakistanCareem partners with Bookme.pk to provide a complete cinematic experience28Careem partners with Bookme.pk to provide a complete cinematic experienceRizwan AnwerClicking HereFollow us onGoogle NewsRizwan AnwerPTCL Audit Reveals Rs624 Million Loss Over Project DelaysTechCrypto PortalTelenor Pakistan Market Share Declines as PTCL Merger Faces DelaysPakistan’s Data Privacy Crisis: Is Your Data Being Sold to Other Businesses, on Dark Web?Islamabad High Court Orders Immediate Removal of PTA ChairmanLeaked Documents Expose India’s Covert Campaign to Shape Kashmir Narrative at UNHRCYouTube Web Player Update Brings Fresh Look to Pakistan UsersThreads Expands DM Settings to Let Anyone Send You Message RequestsGamingPUBG New Updates Comes With THIS Sneaky Trick You Can Use on Your FriendsStandard Chartered Reports 23% Earnings Decline in H1 2025Meta Reels From Ray-Ban Glasses Live Demo Fails at Connect 2025PAC Raises Alarm Over Passport Theft in PakistanAmazon Launches AI Agent to Assist Marketplace SellersNew Crypto Coins to Watch in September 2025: Top Picks, Risks, and StrategiesNADRA Adds Urdu Menus to Pak ID Mobile App In Major UpdateInternet Services Still Remain Slow Throughout the CountryPakistan One Step Closer to Starlink, Others as PTA Set to Grant Fixed Satellite Service LicensesGoogle’s AI Chip Reveals A State of Matter “From A Parallel Universe”WhatsApp, Meta Collects User Data, Former Security Chief WarnsAmnesty Alleges Pakistan Using Firewall, Phone Tapping to Spy on CitizensNETSOL Sells 241,828 Treasury Shares Under ESOSJazzCash Highlights Pakistan’s Drive Toward a Cashless Economy at Money20/20 Middle EastCars, Cigarettes to Get Costlier as Govt Plans Mini-Budget for Flood ReliefAmazon Confirms Prime Big Deal Days 2025, Set for October 7–8Xiaomi 17 Pro Camera Specs Leak Ahead of Global LaunchMediaTek sets September 22 launch date for Dimensity 9500Apple iPhone 17 Charges to 50% in 20 Minutes, But There’s a CatchApple Rolls Out iOS 26 Update: Which iPhones Will Get the Update?Vivo Partners with Atif Aslam to Promote V Series in PakistanMoITT Opens Applications for Pakistan Digital Authority Member RolePakistan Senate to Examine Ufone–Telenor Merger, Spectrum Auction, and Jazz Rs6.58bn CasePTA to Block Unregistered Mobile Devices in PakistanShaza Fatima Confirms Major Telecom Recovery ProgressChina Signals TikTok Sale to US Investors While Holding Back Its AlgorithmPunjab Govt Clarifies Rumors on Sehat Card ServicesLinkedIn Broadens Access to Checkmark Verification for Company PagesPunjab Opens Applications for E-Taxi Scheme 2025Wazirabad Electric Bus Service Launches September 17Islamabad–Rawalpindi Rail Service Launches March 23World Bank and Sindh Govt Plan Yellow Line BRT for KarachiGovt Clears Import of 5-Year-Old Used Cars at 40% DutyPMDC Announces MDCAT 2025 on Domicile BasisBISE Lahore Inter Part-II Result 2025 Toppers AnnouncedPPSC Releases Syllabus for Punjab Jail Department ExamsGates Cambridge Scholarship 2026 Opens for Pakistani StudentsPEC Opens Career Pathways for Pakistani Engineers in AustraliaYouTube Shorts Adds New AI Tools for CreatorsGoogle’s New Offline AI Mode Can Replace Search As We Know ItStudy of 1.5 Million Chats Reveals How People Actually Use ChatGPTxAI Layoffs Hit 500 Workers from Data Annotation TeamAlbania Appoints World’s First AI-Bot “Minister” to Combat CorruptionCrypto PoralData Leak Saga, Privacy Concerns Cast Shadow Over Jazz-NADRA Collab350,000 Hajj Applicants’ Data Leaked on Dark Web, Senate Body ToldTrump Imposes New $100,000 H-1B Visa FeePTA Confirms Massive Data Leak, Senate Panel Demands Urgent Protection LawsiPhone Air Review: Apple’s Thinnest iPhone Redefines DesignDark WebWhat is Dark Web and Why Pakistani Data Keeps Leaking Into It?Punjab Issues 2025-26 Academic Calendar for Inter CollegesPunjab Govt to Enforce Higher Traffic Fines, License BanApple iPhone 17 Pro Max Review: Big Upgrades, Bigger ExpectationsHuawei MatePad 12 X 2025 Debuts with PaperMatte DisplayOracle Eyes $20 Billion AI Cloud Deal with Meta as Shares SoarAI Is Learning to Predict Future, Beating Human ForecastingMassive npm Supply-Chain Attack: Shai-Hulud Worm Infects Over 180 PackagesFBR Goes After 100,000 Influencers Showing Off Wealth OnlineGovt Moves Ahead with Reforms to Cut Power CostsPakistan’s IT Exports Jump 13% YoY in August 2025, Hit $337 MillioniQOO 15: Leaks Reveal Triple 50MP Cameras, and a Game-Changing Q3 ChipXiaomi 15T Series and Redmi Pad 2 Pro Prices Leak Ahead of LaunchJazz Overcharging Case Lands in Public Accounts CommitteeCCP Confirms Two-Week Timeline for PTCL-Telenor Merger DecisionTelenor Flags Regulatory Hold-Up in Pakistan as Asia Moves Swiftly on Telecom MergersTrump Reports Progress with Xi on TikTok DealTikTok Renews Exclusive La Liga Partnership to Attract More Football FansX Lets Premium Users Pay More to Boost Post Reach In-StreamInstagram Rolls Out Brand-New “Shots” Feature To More CountriesSuzuki Alto Owners Can Now Trade In for Latest Model Through HBLPakistan Railways to Outsource Passenger TrainsPunjab Hikes Delivery Fee for Vehicle Files, Plates & CardsAudi Pakistan Partner Faces Legal, Customs CrackdownPunjab Boards Confirm Deadline for 12th Class Second Annual Exams 2025All Punjab Boards 12th Class Results 2025 – Who’s Winner, Girls or Boys?PMDC Reports Record Registrations for MDCAT 2025 Exceeding 140,000FDE Teams Up with Zong to Digitalize All Govt Schools in IslamabadHow Powerful is Microsoft’s Giant AI Supercomputer in Wisconsin?Google Integrates Gemini AI into Chrome on Mac and PCOpenAI, Google Smash Human Records At Programming OlympicsMicrosoft Teams Get a Massive Power-Up in Terms of AI AgentsScientists Find A Unique Way to Increase Battery Health to 1500 CyclesMost Viral Gemini Nano Banana Prompt 2025Critical npm Supply Chain Attack Exposes Global FirmsGovt Plans New Tech & Industrial Projects: AI, Digital Skills, and R&D Facilities AnnouncedScientists Develop A Breathtaking Robot That Can Take Off Like A BirdStuck in VR After Headset Off? New Research Explains Why It HappensIT Ministry Shares New Deadline for Islamabad IT Park CompletionGoogle Tests New AI-Powered Search App for Windows PCsWorldwide Satellite “Sun Outage” Set to Disrupt Internet & TV SignalsDetails Emerge on Huawei’s Ambitious Chips and AI Power RoadmapRDA Signs MoU to Launch Digital Payments in RawalpindiPakistan to Train 1,000 Engineers via Semiconductor Clusters554Microsoft Plans Heavy Investment in Training In-house AI ModelsPunjab Rolls Out Pakistan’s First AI Driving Test VehicleU.S. FTC Probes AI “Companion” Chatbots Over Risks to Children and TeensPakistan Ministry of Planning & Development Launches First URAAN AI TechathonPakistan Among Top Five AI Users as Experts Demand EthicsMicrosoft Brings Anthropic Models into Office 365 Copilot UpgradeTelenor Pakistan Hosts AI Day Highlighting Future-Ready Workforce and InnovationGhanna ButtUAE Unveils ‘Fastest’ Open-Source AI Model to Compete with U.S., China54UK CEO Chaymae Samir Sees Pakistan’s Startup Grit Beyond the StereotypesBuscaro Raises $2M to Expand Tech-Enabled Commuting Across PakistanPakistani Fintech Metric Raises $1.3M Seed Round for Expansion in GCCOnly Two Women-Led Pakistani Startups Make it to ‘Unlock Her Future Prize 2025’ Finalist ListCricFlex: How U.S. Embassy Helped Build A Pakistani Cricket StartupBookme Expands in Saudi Arabia with Resal PartnershipChinese Cities Tops WIPO 2025 Innovation IndexIgnite to Establish Ninth National Incubation Center in SialkotNIC Cohort 4 Deadline AnnouncedNIC Karachi Launches Cohort 14 for Startups, Grants Announced Up to Rs5MStandard Chartered Backs 10 Women-Led Startups With Rs1 Million EachTwo Pakistani Companies Named Among Forbes Asia’s Top 100SECP Opens Doors for Startups with Angel Fund InitiativePartner ContentPress Release120Vivo Expands Y50 Series with New Y50i, with 6,000mAh BatteryApple iPhone 16eApple iPhone 17Apple iPhone 17 AirApple iPhone 17 ProApple iPhone 17 Pro MaxiPhone 17 Series Expected Price in Pakistan After PTA Tax ImpactiPhone 17 Pre-Orders Smash Records While iPhone Air Struggles to ImpressVivo V60 Coming Soon to Pakistan with ZEISS Imaging and Bigger BatteryApple’s latest iPhone Charger Breaks New Ground in Charging TechApple iOS 26 Brings Adaptive Temperature to Home AppiOS 26 Brings Full Urdu Support for iPhone Users in PakistaniPhone 17 Pro Ad Reveals Apple’s Most Cinematic Camera YetApple iPhone Air and iPhone 17 Series Go on Sale WorldwideiPhone 18 Pro Could Keep Same Design but Add Transparent BackHonor Rumored to Equip All Upcoming Flagships with 200MP CamerasXiaomi Confirms 17 Series Launch, Pro Max Design Teased with Rear Display335InvestmentRs200 Prize Bond Draw Result Announced for September 2025Faceless Customs System Causes Rs100bn Loss in Three MonthsHow Pakistani Sattar Buksh Win Trademark Case Against StarbucksFBR Deploys New IRIS Registry Version for TaxpayersPoland to Boost Investment in Pakistan’s Oil, Gas SectorAGP Retracts Rs 375 Trillion Audit Report, Cites TyposMillat Tractors Profit Falls 40% in FY25 ResultsSBP Maintains Policy Rate at 11%Floods Fuel Inflation as SBP Expected to Hold Rate68Punjab Launches Electric Bus Service in SargodhaIslamabad–Rawalpindi Rail Car Project ApprovedLahore Unveils Mandatory License & New Parking Fee StructurePakistan Auto Sales Rise 62% Year on Year in August 2025Pak Car Manufacturers Given Oct Deadline to Align with Global Safety MeasuresYadea Electric Bikes Now Available on Zero Down Payment with 0% InstallmentsYamaha Officially Ends Motorcycle Production in PakistanChangan Launches Alsvin Black Series in Pakistan with New Features37BISE Multan 12th Class Result 2025 Top Position Holders AnnouncedBISE Sahiwal 12th Class Result 2025 DeclaredBISE Faisalabad 12th Class Result 2025 DeclaredBISE Gujranwala 12th Class Result 2025 Toppers AnnouncedBISE Gujranwala 12th Class Result 2025 AnnouncedBISE Sahiwal 12th Class Results 2025 Toppers AnnouncedBISE Lahore 12th Class Result 2025 DeclaredBahawalpur Board 12th Class Result 2025 AnnouncedBISE Rawalpindi 12th Class Result 2025 AnnouncedBISE DG Khan 12th Class Result 2025 DeclaredBISE Sargodha 12th Class Result 2025 DeclaredBISE Multan 12th Class Result 2025 AnnouncedBISE Bahawalpur Inter Part-II 2025 Result: Position Holders AnnouncedBISE Faisalabad Board Inter Part-II Result 2025 Toppers AnnouncedBISE Rawalpindi Board Inter Part-II Result 2025 Toppers Announced80MobilesTabletsLaptopsCompareAvailable
vivo Y12aRs. 20,499Available
Infinix Smart 10 HDRs. 26,999ZTE nubia Focus 2Rs. 48,999Available
Motorola Moto E32Rs. 29,999Available
Samsung Galaxy M05Rs. 20,758Featured
Realme 14TRs. 79,999Available
Xiaomi Mi Note 10 LiteRs. 55,999Available
Vivo V50 Lite 5GRs. 90,000Available
Huawei Enjoy 70XRs. 68,600Available
Oppo Reno 5 Pro+Rs. 82,999Available
Acer Predator Helios 16 (Intel Core™ i9) – 16 inchRs. 774,999Available
Apple MacBook Pro (M3 12-Core) – 14 inch, 18 Core GPURs. 709,999Available
Apple MacBook Pro (M3 Pro 12-Core) – 16 inch, 18 Core GPURs. 700,000Lenovo ThinkPad X1 Carbon Gen 13 (Intel Core™ Ultra 7) – 14 inch, Aura EditionRs. 696,999Lenovo Legion Pro 5 Gen 10 (Intel Core™ Ultra 9) – 16 inchRs. 696,999Upcoming
Samsung Galaxy S25 FERs. 239,999Available
Samsung Galaxy S22 Ultra 5GRs. 289,999Samsung Galaxy S25 EdgeRs. 313,999Samsung Galaxy F56Rs. 88,999Samsung Galaxy XCover7 ProRs. 205,999Apple iPhone 17 Pro MaxRs. 510,000Apple iPhone 17 ProRs. 445,000Apple iPhone 17 AirRs. 420,000Apple iPhone 17Rs. 340,000Available
Apple iPhone 15 Pro MaxRs. 392,000Upcoming
Oppo Reno14 FRs. 99,999Available
Oppo A5 4GRs. 48,999Available
Oppo A5x 4GRs. 28,999Upcoming
Oppo Reno14 ProRs. 219,999Upcoming
Oppo Reno14Rs. 149,999Upcoming
Infinix Hot 60iRs. 33,235Upcoming
Infinix Hot 60 Pro+Rs. 64,999Featured
Infinix Hot 60 ProRs. 59,999Upcoming
Infinix Hot 60Rs. 36,999Available
Infinix Smart 8Rs. 19,999Upcoming
Tecno Spark 40CRs. 29,999Available
Tecno Spark Go 2Rs. 24,000Featured
Tecno Spark 40 Pro+Rs. 69,999Featured
Tecno Spark 40 ProRs. 48,999Available
Tecno Spark 40Rs. 32,999Latest Phones in PakistanAcer Aspire 5 (AMD Ryzen™ 7) – 15 inchAcer Aspire 5 (AMD Ryzen™ 5) – 15 inchAcer Aspire 5 (AMD Ryzen™ 3) – 15 inchAcer Aspire 3 (AMD Ryzen™ 7) – 15 inchAcer Aspire 3 (AMD Ryzen™ 3) – 15 inchSamsungLenovoAppleXiaomiGoogleHuaweiInfinixOppoLatest NewsVivoASUSDellHPLifestyleHow To Buy Cryptocurrency in Pakistan – A Comprehensive Guide How to Launch a Business on a Small Budget: A Step-by-Step GuideA Complete Guide to Sending Money to Pakistan from Abroad How to Successfully Apply for a HBL Credit Card Bank Smart, Debt-Free: Your Guide to NBP Debit Cards in 2025The Ultimate Android Privacy Checklist (2025 Guide)From Classic to Platinum: Choosing the Right Bank of Punjab (BOP) Debit Card for YouEmpowering Rural and Urban Banking With Zarai Taraqiati (ZTBL) Debit CardsBudget-Friendly Backup Solutions for Your Phone and PC in Pakistan How to Transfer Everything to Your New iPhone (A Step-by-Step Guide) BNB to PKRDOGE to PKRADAUSDBNBUSDBTCUSDDOGEUSDETHUSDHYPEUSDSOLUSDSUIUSDXMRUSDXRPUSDADAPKRBNBPKRBTCPKRDOGEPKRETHPKRHYPEPKRSOLPKRSUIPKRXMRPKRXRPPKRADAAEDBNBAEDBTCAEDDOGEAEDETHAEDHYPEAEDSOLAEDSUIAEDXMRAEDXRPAEDADAEURBNBEURBTCEURDOGEEURETHEURHYPEEURSOLEURSUIEURXMREURXRPEURADAGBPBNBGBPBTCGBPDOGEGBPETHGBPHYPEGBPSOLGBPSUIGBPXMRGBPXRPGBPADAINRBNBINRBTCINRDOGEINRETHINRHYPEINRSOLINRSUIINRXMRINRXRPINRADATRYBNBTRYBTCTRYDOGETRYETHTRYHYPETRYSOLTRYSUITRYXMRTRYXRPTRYADAVNDBTCVNDDOGEVNDETHVNDHYPEVNDSOLVNDSUIVNDXMRVNDXRPVNDADAAUDBNBAUDBTCAUDDOGEAUDETHAUDHYPEAUDSOLAUDSUIAUDXMRAUDXRPAUDADACADBNBCADBTCCADDOGECADETHCADHYPECADSOLCADSUICADXMRCADXRPCADAEDPKRAUDPKRCADPKRCHFPKRCNYPKREURPKRGBPPKRINRPKRJPYPKRMYRPKRQARPKRSARPKRSGDPKRTHBPKRTRYPKRUSDPKRWhen Can We Expect Ethereum to Hit $10,000?Bitcoin Eyes $118K As Investors Hope For A Major BreakoutBitcoin Gains 8% As September 2025 Best Month in 13 YearsBitcoin Lingering Around $116K As Focus Shifts to Fed Rate CutsSOL to PKRSUI to PKRGBP to PKRINR to PKRCrypto News# Bitcoin# Blockchain# Ethereum# Binanceregulatory roadblocksaggressive pricingPTAPTCLTelenor PakistanXRP Becomes Crypto Momentum King as $5 Billion Inflows Trigger Rallyposted on LinkedInJanuary 16, 2022[email protected]Data Leaksdata privacyJazzNew Indicators Suggest LockBit 5.0 Ransomware May Be Coming BackYou Won’t Believe How Drugs Are Being Smuggled Across Pakistan Right NowIHCPIA-Owned Roosevelt Hotel Gets Interested Bidders Deal Amid JLL ExitNCCIA questions PTI founder: Is his social media controlled by CIA, RAW or Mossad?Web PlayerYoutubeWhatsApp to Add Instagram-Like Close Friends Feature for Status UpdatesSnapchat Introduces Permanent Chat Feature and New Group StreaksUS Government Says TikTok Sell-Off Deal Has Been Agreed UponAustralia to Ban Social Media for Under-16s by December# Facebook# WhatsApp# Twitter# Social Media# Instagram# Tiktok# YoutubeInstagram Fixes A Major Story Bug for its Users Across the GlobeTop Influencers Ignore Cyber Crime Agency in Gambling CaseYouTube rolls out global access to multi-language audio feature for creatorsChina Punishes Social Media Executives for Negative and Trivial PostsReddit Rolls Out New Subreddit Activity Metrics: Here’s What’s Changing169MetaThreadsFans Rejoice as Marvel’s Wolverine, Venom Games Rumored for 2026Leaked Document Suggests A Fan-Favorite Returns in Resident Evil 9Fortnite vs. Roblox Heats Up as Epic Lets Creators Cash InFortnite’s New Delulu LTM Arrives This Weekend: Here’s What You Need to KnowWhen Can Fans Get Their Hands on Fortnite Update 37.30?Sony Introduces PlayStation Family App to Monitor Gaming ActivityYou Can Now Betray Your Friends In Fortnite For Free Skins!India Online Gambling Ban Triggers Shift to Offshore Betting Sites# Gaming# fortnite# Epic Games# Playstation# Sony# PUBG# XboxBlockchain Games Go Mainstream As Millions of Gamers Join the Craze“There Might Be An Idea”: The Last of Us Creator Teases A Third GameFortnite Awards Free New Version of Beloved Skin with Blitz Royale WinFortnite’s New Update Let’s You Top-Up V-Bucks As Much As You NeedPakistan to Launch Esports Federation and Gaming Hub SoonPUBG Introduces 37.2 Update With G-DRAGON Collab, New MapsFortnite v37.20 Update: New Skins, Weapons & Features ExplainedWhen is the Fortnite v37.20 Update Downtime?41KraftonPUBG Mobile# Profit# Federal Budget 2025-26# Budget 2025-26# ECCFBR Introduces Whistleblowing System to Track Tax Evasion, Reward TipsSECP Draft Actuarial Valuation Rules 2025 ReleasedPakistan Launches Trial of National Digital CurrencyFBR Resolves Major Income Tax Portal Bug for Salaried ClassSBP Foreign Exchange Reserves Rise to $14.34 BillionSBP Warns Floods Could Challenge Pakistan’s Economic RecoverySenators Flag SBP Clause Allowing Officials to Set Own SalariesTrump Wants EU to Hit India and China with 100% TariffsSBP Tightens Rules, Banks Must Compensate Losses in 2 DaysPakistan Public Debt Skyrockets as Govt Borrows Rs25.4bn Every DayCCP Approves Heavy Electrical Complex Acquisition16BankIncome StatementStandard CharteredCan Amazon’s Jayhawk Glasses Beat Meta’s Ray-Ban Ones? Here’s One Way!Design Renders of Huawei Watch Ultimate 2 Leak Ahead of Expected LaunchMeta Accidentally Leaks First Look Of Their Next-Gen AI Smart Glasses# AMD# Wearable Tech# Apple Vision Pro# Ray-Ban# Apple WWDCPakistan to Launch Local Chromebook Assembly Line, Aims for Half-Million Devices AnnuallySamsung Adds Spatial Photos & Videos Ahead of Galaxy XR Headset LaunchHuawei Teases Major Battery Improvements for Watch GT 6 SeriesAirPods Pro 3 Launch Expected This Fall With Health SensorApple Teases Vision Pro 2 Release Date, Now in A Sleek New LookHere’s All The Rumors About Apple Watch Series 11 We KnowYou Can Now Text Via Satellite Using Garmin Fenix Pro 8 Watches!$1M and Counting: Rokid Glasses Spark a New Era of Futuristic EyewearRumors Hint at Dockable PS6 Handheld That Could Outperform PS5Vivo Challenges Apple, Meta with Lighter, Cheaper VR Headset4https://www.techjuice.pk/wp-content/uploads/2025/09/WhatsApp-Video-2025-09-18-at-11.55.23-AM.mp4Meta Connect 2025Ray-BanPakistan Launches CEGA, Biggest Gaming & Animation Initiative with HUM NetworkIndia Proposes Purchase of 114 Rafale Fighter Jets After PAF HumiliationPTA Chairman Files Intra-Court Appeal Against Removal Order by IHCPECA Amendment Targets Internet Service ProvidersPIA Temporarily Halts Flights to CanadaIslamabad Police to File FIRs for Wrong-Way DrivingPunjab Launches Housing Plan for 57,000 Affordable HomesPakistan to Welcome Electric and Gas Bikes from China’s Top E-Trike BrandIESCO Launches KYC Drive to Update Consumer DataGovt Seeks IMF Approval for Flood-Hit Power Bill ReliefPharma Exports Surge 34% After Deregulation, SIFC Pledges SupportUtility Stores Corporation Announces Sweeping Job Terminations853NadraPassportPublic Accounts CommitteestarlinkAI AgentAmazonDigital BusinessWhy Are Altcoins Like Sui, Dogecoin, and MYX Dropping?Why Ether Might Outperform Bitcoin This YearBitcoin Faces Liquidation Risk as Gold Hits $3.7KTrump Family Sparks Major Surge in Crypto, Altcoin VenturesPakistan Eyes Crypto Rules as Bitcoin Price DipsEx-FBR Chief Warns Crypto May Rival Hawala in Usage69NICOPPak ID Appmay continue to face slower browsingslow internetAI chipsQuantum PhysicsA Wild Hack Turns Disposable Vape Into a Fully Functioning Web ServerPakistan Signs Pact with China to Build Space Training CentreMark ZuckerbergWhatsAppAmnesty InternationalChina firewallESOSNETSOL TechnologiesPakistan Stock ExchangeCashless economyFinancial InclusionJazzCashFBRIMFImported GoodsE-commercePrime dealsFBR Issues New Tax Rules for Online Marketplaces & CouriersE Commerce Tax Debate Escalates As Senate Panel Demands ClarityAlibaba KEL Awards 2025 Honors Pakistan’s Top Exportersnew leakxiaomiXiaomi 17 seriesMediaTekQualcommiPhone 1717 Pro17 Pro Maxslimmer iPhone Airearly testingiPhone 17 seriesApple iPhone 17 SeriesApple iPhone 16 SeriesApple iPhone 15 SeriesApple iPhone 14 SeriesApple iPhone 13 SeriesApple iPhone 12 SeriesApple iPhone 11 SeriesApple iPhone SE (2020)Apple iPhone SE (2022)AirPods Pro 3iOS 26iPhonevivo V60Vivo mobilesVivo V seriesPTA Chairman Reinstated as IHC Suspends Removal OrderIT Ministry Confirms New Submarine Cable Project for PakistanNA Panel Grills IT Ministry over Submarine Cable Cuts, Internet Slowdown# PTA# PTCL# Jazz# Telenor# Telecom# Ufone# ZongTech DeskRed Sea Cable Cuts Could Take Weeks to RepairPTA Breaks Silence on Reports of Massive Telecom Data LeakPTA 3-Year Survey Exposes Complaints and Telco Service GapsPakistan’s Auditor-General Denies Misreporting in Federal Audit Documents62MoITTPDA5G spectrum auctionTelenor–Ufone mergerCyber FraudDIRBSInternetNTCUSFsourceChinaTiktokUShealthcarePunjab GovernmentSehat CardlinkedInE-taxiElectric Bus PunjabWazirabad TransportIslamabad–RawalpindiCDAIslamabad RailPublic transportKarachi Transport PlanWorld BankYellow Line BRTJail DepartmentPPSC ExamsPrison LawsFederal Health MinisterMDCAT 2025PMDCBISE LahoreIntermediate Results 2025Cambridge UniversityGates ScholarshipHigher EducationCPD FrameworkEngineers AustraliaPEC InitiativeVeo 3YouTube ShortsGemma AIstudy’shallucinationsChatGPTOpenAISam AltmanData AnnotationElon MuskxAIArtificial Intelligence BotFaysal Bank’s Noor Cards pageUSDAEDUSDAUDUSDCADUSDCHFUSDCNYUSDEURUSDGBPUSDINRUSDJPYUSDMYRUSDSARUSDSGDUSDTHBUSDTRYBTCCNYBTCETHPakistani startupstech newscryptocurrency updateslatest mobile priceseditors[at]techjuice.pkpartnerships[at]techjuice.pkjobs[at]techjuice.pkbusiness[at]techjuice.pkinbox[at]techjuice.pkinbox[@]techjuice.pkEURAEDEURAUDEURCADEURCHFEURCNYEURGBPEURINREURJPYEURMYREURSAREURSGDEURTHBEURTRY1,998above the $117,000 markCrypto market trendsECC approvalPakistan auto policyconfirmedgained accesshajjExperts Warn ChatGPT Calendar Integration Flaw Lets Attackers Steal Sensitive EmailsCourt Rejects Ducky Bhai Bail Plea in Gambling Apps CaseFaisalabad Electric Buses to Start Service on Seven RoutesFBR Crackdown on Jewelers as 60,000 Shops Face Tax InvestigationApple to Introduce Touchscreen MacBook in Late 2026What’s New on Netflix This Week: Must-Watch Shows & MoviesSECP Proposes Major Changes to Company Share RegulationsChina Launches Two-Month Social Media CrackdownNCERT Issues Urgent Security Warning on Adobe Commerce, Magento PlatformsInstagram’s AI Can Now Catch Teens Who Lie About Their BirthdaysNIC Hyderabad Marks 3rd Anniversary with Graduation of 32 StartupsSony Unleashes Its AI Engines: From Anime Dubbing to Game Dev EfficiencyT-Cash Card Kiosks Set Up at 11 Lahore Metro StationsKarachi Man Jailed for Six Years for Blackmailing Woman on Facebookdata privacy crisisnCERTPECApunjab govt.road safetyTraffic FinesCement Giant Enters Automotive SectorSenate committeeCould A Futuristic AI Cocoon Make Plane Crashes Survivable? Scientists Weigh IniPhone AirMacBook AiriPhone 12 ProiPhone 14 ProXiaomi Reveals Rollout Timeline for HyperOS 3 UpdateHuawei Watch Ultimate 2 Review: A Premium Smartwatch With Power and StyleiPhone 17 Review: Apple’s Biggest Upgrade for the Base ModelManticAIAI AdvancementsUAE Bans Work and Tourist Visas for Nine CountriesAcademic CalendarPunjab HEDSyllabus UpdatesinfluencerNon-FilersGovt Weighs New Taxes to Fund Islamabad’s Jinnah Medical ComplexPunjab Announces Electricity and Tax Relief for Flood-Affected FamiliesinformingflaggedleakMatePad 12 X15T Series launchleaksxiaomi mobilesincluding PakistanMalware AlertnpmShai-HuludCCPPTCL-Telenor MergerDonald TrumpH-1B visaU.S. ImmigrationScientists Could be Closer to Turning Nothing Into SomethingNew Study Reveals Sodium Batteries Still Hold 90% Capacity After Heavy UseGoogle, Microsoft and Amazon Warn H-1B Employees to Stay in the USLa LigaStreamingEconomyexportsTradePIA Audit Reveals Rs9.43bn Loss from Free and Discounted TicketsTECNO Launches Latest Spark 40 in Pakistan# iPhone 17 series# iPhones# Vivo mobiles# iPhone 17 leaks# iPhone Air# TabletsiPhone 17 Brings Dual Capture: Record with Front and Rear Cameras at OnceApple iPhone 17 Pro Teardown Confirms Bigger Batteries in eSIM-Only ModelsSamsung Might Introduce One UI 9.0 Following the One UI 8.5 ReleaseSamsung Shares One UI 8 Update Roadmap for Galaxy DevicesGoogle Releases Android 16 QPR2 Beta 2 For Pixel devices12departmental inquiryrejectedquestionedSenate# Data Leaks# Dark Web# Malware Alert# Nadra# drug smuggling in Pakistan# LockBit 5# nCERT# Crypto drug smugglingrecordedCar FinanceHBLSuzuki AltoBYD Shark 6 Earns Major Safety RatingPunjab Green Sticker Crackdown Begins as Deadline Endsfinalize a dealAudi PakistanCustoms PakistanPremier SystemsiPhone 17 Pro Max#iCanthttps://t.co/s6SFaLTRSJSeptember 9, 2025pic.twitter.com/0uCZBw467jSeptember 11, 2025InstagramMicrosoftNvidiaOracleScientists Stunned as Sodium Batteries Hold 90% Capacity After Repeated UseGeminiZuckerberg Admits AI Bubble May Be Real, But Meta Doubles Down on Big BetsxAI Rolls Out Grok 4 Fast With Smarter Efficiency and Lower CostsElectricity PricesEnergyExportPunjab ExciseVehicle Registration12th Class Results 2025BISEPunjab Boards91Gaming PhoneiQOO 15 leaksUK’s largest AI supercomputerAI SupercomputerLi S BatteriesScientific Breakthrough23 NUST Researchers Ranked In the Top 2% Researchers of the WorldMuhammad MuneebUS Finances Pakistan Government For Production of Renewable Energy SourcesIndian Embassy Website Hacked by Kashmiri Hackers on India’s Independence DayTechjuice TeamIT-related exports will surge to five billion dollars, Prime Minister Imran Khan informedAhsan ZafeerGoogle enters into a news content sharing deal with Seven West MediaFacebook has removed more than 450 fake accounts in PakistanNaima RabbiePunjab Qeemat app has hit 700K downloadsPriceOye.pk raises 6 figure funding in Pre-Series Round led by US-based VCNational Freelance Training Program open now for its second batchNetflix is offering a collection of its ‘original’ TV shows and movies for freeThis Pakistan-based startup will help fix your email marketing problemsCTLC to create job opportunity for women living in undeserved areasPTA have asked TikTok to take down obscene content for viewership in country.219Microsoft 365 Copilot licenseCopilot AIPost EngagementTwitter X# Scientific Breakthrough# 3D printing# science# AI Advancements# china helping pakistan# Cern# medicine# SUPARCO# Superconductors# RoboticsScientists Turn Cement into Energy-Storing Material That Recovers ItselfNew Light-Powered Chip Makes AI Up to 100× More EfficientScientists Secretly Crack the Code to Longer-Lasting Lithium BatteriesScientists Make Quantum Signals Flow Like WiFi Through Normal CablesCERN Delegation Reviews Pakistan Scientific ProgressBreakthrough 3D Printing Method Creates Record-Setting SuperconductorsScientists Test Social Media with Only AI Bots, Chaos Soon FollowedYour Household Gadgets Could Soon Be Battery Free, Scientists Claim5Pakistan RailwaysPassenger ServicesTrain Outsourcing99Annual Exams 2025nCERT Advisorysupply chainMicrosoft to Build UK’s Largest Supercomputer in $15B AI Infrastructure DriveMicrosoft Expands Copilot Reach with Free Chat in Word, Excel, and MoreMicrosoft Seals A Brand New AI Deal With Nebius, Sending Shares SoaringHackers Exploit Raw Disk Reads to Steal Senitive Files, Bypass EDRMicrosoft’s Cloud Service Restored After Red Sea Cable OutageOpenAI is Building a Jobs Platform to Rival LinkedInMicrosoft Levels Up with First-Ever In-House AI ModelsWindows 11 Improves Bluetooth Performance for Games and CallsPakistani brand Crumble enters roast war with Blinkit and ZomatoDeepfake AI nudes created by Telegram are accessed by millions of usersLooking to work in Tech? Here are the top skills for IT Professionals in 2024Spotify Introduces Music Video Support to 85 New MarketsInstagram says human reviewers, not AI, caused recent moderation issuesTesla unveils the Robovan at “We, Robot” event: When will it be available for purchase?After Tecno, Xiaomi Pakistan advises against purchasing mobile phones from “PriceOye”Hackers Steal Personal and Transaction Data in MoneyGram Security BreachStarlink coming to Pakistan: PTA issues required licenseEpic Games Sues Google and Samsung Over Anti-Competitive App Store Practices and Third-Party App RestrictionsChina’s Tencent Releases Large Language Model, Opens it For Enterprise UseAbdullah ShahidApple Reportedly Spending ‘Million of Dollars Each Day’ for AI TrainingMeta to Discontinue ‘Facebook News’ Feature in UK, France, Germany29China-Pakistan Joint Action Plan 2025-29 Unveils Bold Tech Push for Digital FuturePakistan Wins Youth Scrabble Championship for Sixth TimePakistan and El Salvador Decide to Forge A Crypto-Based Trade AlliancePakistan airspace closed until May 11 for fear of an all-out warPakistan blinds India’s military satellite in a first space blitzOPPO Reno 13 Series Launches Globally—Is Pakistan Next?Huma IshfaqHutchison Ports Announces $1 Billion Investment in PakistanAlbaik is Coming to Pakistan! Saudi Chain Confirms Expansion PlansPakistan Ranked Second in Internet Shutdowns in 2024, Facing Digital Economy SetbacksTehniyat ZafarPakistan Announces Revised Passport Fees for E-passports, MRPs, and Lost PassportsNo More Address Restrictions for Passport IssuanceFBR Confirms No Further Extensions for Income Tax Return DeadlineUBL Proposes Merger with Silkbank111Federal Directorate of Education (FDE)Schools DigitalizationZongTechJuice Circle 2018 concludes after connecting 60 startups and 12 mentorsShaoor MunirThese websites are offering Black Friday deals in PakistanThe 10 most demanded roles for Computer Science graduatesMaryam DodhyHuawei P10 Lite ReviewZong 3G/4G Internet Device Packages: Dongles, Wingles & MiFi 2019Maheen KanwalUfone Advance Balance Code 2019 – TechJuiceWarid Advance Balance Code 2019 – TechJuiceJazz Advance Balance Code 2019 – TechJuiceTelenor Advance Balance Code 2024 – TechJuiceZong Advance Balance Code 2019 – TechJuiceTelenor 3G/4G Device Packages: Dongles, Wingles & MiFi 2019NESTio enters into partnership with Oman Accelerator FundAlibaba Officials visit could get $400 million investment to PakistanAli Raza78DeepMindGPT-5Science AdvancesRoboFalcon2.0grantedIslamabad IT ParkIT Ministrysouth koreaChina will soon be the leading 5g chip manufacturer worldwideIntel has been beaten up by Nividia as the valuable Chipmaker in the USInternational students must leave the U.S if their Universities are not offering in-person classesThe U.S. government is considering banning popular Chinese social media app TikTokGmail finally works with the iPad’s split-view multitaskingGoogle to integrate Chat feature in the Gmail Mobile App following Google MeetOverseas Pakistanis got scammed by fake NADRA website for over 2 yearsGoogle has removed 25 malicious apps involved in stealth of Facebook credentials of usersGoogle rolled out Google Map update for Android Auto mobile appA security glitch in MacOS can invite hackers to acquire user’s personal informationGovernment of Pakistan rolled out a travelling instruction app for all the overseas passengersApple all geared up to launch a new cheap iPad series in months to come.An unannounced dark-theme mode rolled out by Facebook43# Cybersecurity# Malware# National Cyber Crime Investigation Agency (NCCIA)# cyberattacks# Cybercrimes# ransomware# NCCIA# Call Center ScamHackers Exploit Docker APIs Using Tor, Build Self-Propagating BotnetNCERT Warns Of A Code Injection Vulnerability Affecting WorldwideInterior Minister Takes Notice of Illegal Sale of Citizens’ Private DataPetition Filed in IHC Seeking Ban on Gambling Apps in Pakistan‘Grokking’: How Hackers Hijack Grok AI to Push MalwarePunjab Govt Forms CERT to Tackle Cybercrime and Online ThreatsVibe Hacking Lets Chatbots Aid Data Extortion Across Sectors9AI toolsNano BananaPakistan already faces frequent internet disruptionsPakistan internet issuesTikTok’s New Creator Tool Exposes the Hottest Trends Before They Go ViralBTC, ETH, and XRP Under Pressure as Key Supports Near Breaking PointsFortnite Tightens Moderation in Delulu Mode as Bans SurgePSEB InitiativeVR HeadsetsGoogle Updates Gmail with New Purchases View and Smarter Promotions TabGmail Makes Package Tracking Simpler with Upgraded Delivery Alerts87Pakistan’s Power Sector Circular Debt Hits PKR 1.6 Trillion in July 2025WhatsApp on iPhone Now Lets You Set Reminders for Specific Messages47Here are some of the best Twitter reactions to Bill and Melinda Gates’ divorceHamza ZakirChangan Motors starts testing driverless cars in PakistanPM Imran thanks overseas Pakistanis as RDA funds cross $1bn markUET Peshawar develops low-cost solar panels to be unveiled this weekFacebook planning to launch three new projects in Pakistan: Zia Ullah BangashChinese firm to establish electric vehicle plant in PunjabPakistani student secures Young Scientist Award 2021 in BiotechnologyPakistani multimillionaire to launch payment app to boost employment opportunitiesPakistan is now the world’s third-largest contributor of online laborGovt actively monitored internet during lockdown: PTADid PIA just spot a UFO? Media in frenzy over “extraordinary” objectHEC just released its final decision on conduct of exams (hint: it’s controversial)Telecom firms in hot water due to illegal use of boosters and amplifiers117Xiaomi Joins 3nm Race with XRing O1 LaunchCybercrime Jobs Are Available On The Dark Web: Pay Up To $20K Per MonthApple To Soon Launch Apple AR Headset With Mental Well-Being FeaturesApple to Release the World’s First Foldable iPad Next Year5 Gadgets that Didn’t Sell Well in 2013Qurat ZafarThe rise and rise of SMSallEzaaz WaseemSaba Gul – Entrepreneur of the MonthFatima AliUmair Khan, Application Development Leader (Ephlux)Laila RehmanNexus 5 and Android KitKat – Everything you need to knowUsama Faiz12 exceptional Pakistani Women in Business and TechnologyFatima Muhammed10 inspiring graphic design resourcesAdnan JabbarAndroid KitKat 4.4 – Everything you need to knowiOS7 Update – Are you Ready to meet iOS7?10 Pakistani startups that can make it big – 2013iPhone 5S 5C announcement by AppleTalha MasoodSamsung Galaxy Note 3 and Galaxy Gear Smart WatchWeekly round-up of Tech NewsFatima Rizwan←1552553This week in Tech – Pakistan6 Companies that ended up being Technology Business5 Must Watch Movies for Aspiring EntrepreneursWhat’s in your bag, Amna Tariq?ChatGPT Concerns Grow as Experts Warn of Major RisksOpenAI Opens Up Projects Tool to All ChatGPT UsersOpenAI Adds Parental Controls to ChatGPT in Response to Safety ConcernsMore Govt Websites Found Using ChatGPT After PMD ControversyChatGPT Uses Google Search To Pull Real Time Answers: ReportApple Empowers IT Teams to Manage ChatGPT for Enterprise AccessDecentralized AI: The Hidden Contender Quietly Challenging Tech GiantsAnalysts Suggest ChatGPT Web Power Is Fading to Old Search Giants21digital paymentsFinancial ReformsRDA DigitalizationInternet Archive resumes operations in read-only mode after DDoS attacksSpotify Tests Making Lyrics a Premium Only FeatureChina to Launch $40 Billion State Fund to Boost its Semiconductor IndustryPM Modi Meets Nvidia CEO to Discuss AI Potential in IndiaMicrosoft to Remove Wordpad from Windows After 30 YearsWhatsApp Android Might Soon Get New Interface With White Top BarApple Patents Video Game Like Display on WindshieldGoogle Introduces Generative AI to Search in India and JapanGoogle Now Blurs Sexually Explicit Images by DefaultInstagram Might Introduce Longer Reels to Compete With TikTok32Anthropic Blocks Chinese Companies from Using Its AI ServicesHow DeepSeek and Open‑Source AI Models Disrupt Big Tech DominanceU.S. Lawmakers Propose Ban on Chinese AI in Federal AgenciesDeepSeek faces U.S. scrutiny over military links & export loopholesBrowserVenom Malware Strikes via Fake DeepSeek InstallerThe DeepSeek Scam That’s Spreading Like Wildfire Across the InternetDeepSeek’s New AI Model May Mirror Google’s GeminiDeepSeek App outage disrupts Users, now partially RestoredSouth Korea Accuses DeepSeek of Illegally Sharing User DataBMW Integrating DeepSeek in China Models This YearThe Browser That Lets You Use All AI Models In One PlaceIndustrial GrowthPITACSkills DevelopmentNADRA Adds Birth, Death Registration to Pak ID AppSnapchat Unveils Snap OS 2.0 to Run AR Spectacles GlassesPunjab, FAST-NUCES Partner for Global IT CertificationsNADRA Introduces Face Recognition for Elderly CitizensChina-US Chip Trade Dispute Deepens with New InvestigationsGlobal Smartphone Output Tops 300M Units in Q2 2025Ethereum On-Chain Growth Pushes ETH Toward $5KHuawei Watch Ultimate 2 Adds Underwater MessagingGoogle Chrome Adds Gemini AI Mode with Smart FeaturesIslamabad IT Park to Create 10,000 Jobs by Dec 202519Kaspersky-reportAI ChatbotsMeta to Add New AI Safeguards After Teen Safety ConcernsMeta Under Fire for Creating Flirty Chatbots of Celebrities Without Consent, Including Child ActorsThreads Tests Expandable Text Attachments for Longer PostsMeta Taps Midjourney Models for Advanced Image and Video Features18Apple’sPakistan aisurveyGoogle’s Gemini AI Faces Scrutiny Over Child Safety RisksHackers Are Now Hiding Malware Inside AI Chatbot Images: Here’s How To Stay SafeAI Therapy Chatbots Pose “Significant Risks,” Stanford Study WarnsMeta Tests AI Chatbots That Message You FirstResearch Says We Are Sealing Ourselves In An Information BubbleYouth Turns to AI Bots and Social Media for News, Study RevealsMeta AI Public Search Issue Sparks Privacy Concerns Among UsersWhatsApp Introduces No-Code AI Chatbots for UsersWhatsApp is Ready To Introduce Personalized Chatbots SoonSufyan SohailPunjabadvanced AI chipsGoogle Photos Upgrades Image-to-Video Feature with Veo 3 PowerWarner Bros Discovery Sues Midjourney Over AI Piracy ClaimsMistral AI Closing in on $14B Valuation as European AI Arms Race Heats UpWhy Are Robots Still Lagging Behind AI? Here’s What’s Going On!Apple’s Siri to Get AI Search With Google Gemini SupportWordPress Introduces Telex a Fresh AI Playground for DevelopersMusk’s Grok AI Makes Shocking Comeback in U.S. Govt Contract BattleChina Rolls Out Mandatory AI Education for Children Across SchoolsGoogle Details Gemini AI Limits for Free, Pro, and Ultra SubscribersApple AI Lawsuit Alleges Use of Copyrighted Books for TrainingGovt to Offer AI Financial Incentives to Boost Local InnovationAnthropicCopilotMicrosoft 365AI ExpoTelenorPakistani StartupsOpenAI Warns of Ongoing AI Hallucination ChallengesReports Suggest AI Job Impact Threatens Roles But Not Entire JobsGoogle Translate Adds Practice and Live Translate to Teach SpeakingGovt Vows to Empower Private Sector to Propel Pakistan’s Blockchain RevolutionGoogle Photos Introduces Conversational AI EditingYouTube Introduces AI-Driven Age Verification SystemAreeba AhmedMeta Accelerates AI Dominance With “Project Prometheus”Google’s AI Summaries Causing Sharp Drop in News Website Traffic, Study FindsHONOR to Introduce New AI-Focused Smartphone in PakistanMeta Names AI Executive Connor Hayes as New Head of ThreadsEntrepreneurial CultureMehfooz AIUnlock Her Future PrizeMistral AI Adds Voice, Projects, and Image Editing to Le ChatOracle Launches MCP Server to Power AI-Driven Enterprise Data AccessUS Teens Turn to AI Friends, But at What Cost?Gmail uses AI to block 100 million spam emailsThis AI concealed data from its creators on purpose to cheat at assigned taskShaheryar EhsanThis new AI creates realistic photos of food that doesn’t even existMIT scientists intentionally made a psychopathic AI from Reddit imagesTalha SaqibADDO AI, Pakistan’s first artificial intelligence company celebrates its one year of journeySajeel SyedThis AI tool by Nvidia is capable of making fake videos which look quite realCEO Tesla Elon Musk predicts that AI will be the terminator for human raceThis Artificial Intelligence algorithm can detect whether you are gay or straightAli LeghariA computer program has written the next Game of Thrones book, turns out Varys will kill KhaleesiFacebook’s new Artificial Intelligence system scans your private messagesMicrosoft’s new artificial intelligent robot is a racist teenager5253NED students develop Pakistan’s first AI rice quality analyzerNeuromorphic Computing and how it will change our livesSamsung’s Project Neon gives us a look at the world’s first ‘artificial human’Boston Dynamics parody shows a robot being done with human tortureInnovationVenture CapitalFinTechPakistan’s first EdTech company acquired in a deal sub $100 millionAsra RizwanEVERYTHING you need to know about She Loves Tech competitionMeet the first startup cohort of Innovation District 92National Incubation Center Islamabad is now accepting applications for its 4th cohortMIT Enterprise Forum Pakistan invites applications for Summer Entrepreneurship BootcampFounder & CEO of Popinjay Saba Gul steps awayBlackbox Connect is now accepting applications for their Silicon Valley programNational Incubation Center Quetta inaugurated by PM at BUITEMSInvest2Innovate launches one of a kind toolkit for Pakistani StartupsMeet Cykiq, a Pakistani bike-sharing startup aiming to disrupt public transitPakistani startups can now apply to Asia’s first Google Demo DayAttention: These 3 startup incubators are now accepting applicationsHealth-tech startup Pliro launches health awareness series for students8Pakistan Virtual Asset Regulatory Authority Invites Global VASPs for LicensingPeshawar Board Records 56% Failure Rate In Class 11Moody’s Lifts Pakistan Rating to Caa1 and Stable OutlookMDCAT 2025 Exam Pushed to October 26 Amid Nationwide Floods15Pakistani Startup Icon Backs UAE Fintech’s Record $48M FundingCareem to Exit Pakistan’s Ride-Hailing Market This JulySindh Govt to Introduce a new System for Bykea, Yango and inDriveCareem Launches Mass-Commute Service To Help Bussiness In PakistanSenoria KhursheedRide-hailing Service Careem may become Cheaper Post-Uber ShutdownFizza AkbarUber Shuts Down Service in Major Cities Including Karachi and IslamabadCareem acquires MUNCH:ON to expand Food offering on the Super AppUsman AslamCareem launches carpooling services4.3 million women used Careem for mobility, taking 32+ million tripsCareem to bring back bonuses and guarantees, awards best performing Captains of 2021Expanding the corporate portfolio, Careem partners with Educative to provide mobility solutionsCareem invested $100 million since 2015, created 800,000 employment opportunitiesCareem distributes free smog kits to Captains for a fourth consecutive year14BookmeE-TicketingResalMoPDSIURAAN AIInside Story of A Pakistani CEO’s US Startup’s $200M GrowthPakistan’s Uplift AI Just Made Urdu Voiceovers Smarter and FasterZarea Launches Dubai Subsidiary to Boost Global B2B ExpansionPakistan Investor Summit 2025 breaks Records with 100+ Startups, 400 Investors at NIC KarachiBusCaro Claims No Investment Ties with SarmayacarNIC Karachi’s 13th Cohort Nears Grand Finale of InnovationShark Tank Pakistan: A Bold Attempt to Revitalize Entrepreneurship or a Missed Opportunity?Pakistan’s Farmdar Has Just Launched a New FinTech Startup in BrazilPakistani Startups’ Investments Boosted by 30% in Four Years: IT Minister7Cohort 14NIC KarachiPakistan InnovationDeepSeekK2 ThinkOpenAI Denies California Exit Amid Restructuring ProbeGoogle Makes AI Search More Local with Five New LanguagesCould Google AI Mode Become the Default Search Experience Soon?Google’s Gemini Update Brings Audio Support and Expanded Search Language SupportEntrepreneurshipSECPUber invests in Lucid & Nuro to launch Premium Robotaxi ServiceUber Eats is Reportedly Developing AI Chatbot that Offers RecommendationsApple Car Play Is Coming To Uber Driver AppI Had To Cancel My Christmas Plans Because Car Would Not Charge In Freezing Weather:Tesla Owner“Uber Business Model Is Absolutely Unsustainable”- Former EmployeeUber Eats Starts Delivery of Cannabis in TorontoInDriver Announces Expansion As Uber Steps Back in PakistanGTA VI And Uber Were Both Hacked By 18-Year-Old Britains18 Year Old Hacks into Uber, Forces Ride Sharing Giant to Shut Down its SystemsUber raises the security bar in Pakistan with new and improved background checksUber set to provide its riders and partner drivers free vaccination tripsUber & Easypaisa partner to introduce cashless payments11BusCaroride-hailing appsNIC CohortNIC IslamabadKASB’s KTrade raises $4.5m to get Pakistanis to invest in Pakistani stocksTikTok Boosts Digital-Wellbeing Awareness in PakistanLearn how to raise funds for startups in a live course on AirschoolHBL Inks Landmark Investment in Finja, Pakistan’s Leading Digital SME Lending FintechDaraz & Femprow Trying to Activate Women Contribution in PakistanHBL and Katalyst Labs partner for Startup Acceleration and Women Leadership EnablementAmazon Business Centre declared Software Technology Park by Ministry of IT and PSEBK-Electric partners with Foodpanda and BefilerWhat are the Major Challenges that Smart Cities face?On the United Nations International Day for Creativity and Innovation, Careem celebrates and fosters the growth of Startup CultureHBL delivers stellar performance with Q1 2021 profit doubling to Rs.14.5 billion, with an enhanced focus on serving its customersCareem to ‘Explore Ramzan’ by Customising Super App with New Features 75websitePSLU.S. EmbassyWearable TechForbes AsiaForbesNayapaypakistan startupsPakistani Startups Will Have A Hard Time Raising Funds In 2023Demo50 might be your chance to get up to $1 million in investment on your doorstepPakistan made e-bike Teleport MODEL T1 is launching on 18th DecemberUber sells self driving car business to autonomous driving startup AuroraAllSecure Team – The AppJuice InterviewThe AppJuicePakistani Startups – Potential Risks involvedTechJuice Interview: Ibtesam Sharif – CEO of DataArc SolutionsFrom great idea to Successful Startups: 5 Key StepsA visit to Plan9 Incubator on Demo DayPakistani Freelancer earned 1 Million from a single Wordpress themeThe AppJuice Interview: Ali Rehan CEO of GroopicGoogle Play US Store, Anywhere in the World118New plans with Plan9 this yearAlexandre Parizeau, Producer (Ubisoft) – The AppJuice InterviewStartup Weekend goes to PeshawarMuhammad Uzair, Chief Designer (Ephlux)Igniteincubation centersSialkotYango Tech partners with Naheed Supermarket to power grocery delivery through SuperApp in KarachiTecnoNothingOnePlusSonyZTEApple iPhone 15 Pro MaxApple iPhone 16 ProApple iPhone 15 ProAcerAlcatelAsusBlackBerryHaierHonorHTCLGMeizuMicromaxMotorolaNokiaPanasonicQMobileRealmeverykoolVodafoneAccelerate ProsperityPakistan Startup newsEY announces Imran Aftab of 10Pearls as an EY Entrepreneur Of The Year® 2022 Mid-Atlantic Award WinnerCareem Partners With Total Parco To Provide Its Captains With Speedy Mobility SolutionsBig9 Disruptive Technologies Transforming the Real Estate SectorCareem Engineering offers remote global opportunities for PakistanisTelenor Pakistan Bags Network Transformation Awards 2020 for Community Crisis SupportCustomers donate PKR 21.5 million through Careem Super App rewardsTelenor Microfinance Bank receives US$45 million Equity Injection to continue its Growth on Digital StrategyCareem partners with Coded Minds to Offer Educational Services to its Captains’ FamiliesTelenor Pakistan and National Highways & Motorway Police explore areas of collaboration for improving governance through technologyEasypaisa joins hands with Rawalpindi Chamber of Commerce and Industry to facilitate Digital TransactionsIn cooperation with the World Food Programme (WFP) Careem provides its customers with a chance to Donate and help the People of BeirutNow pay your SNGPL bills directly through EasypaisaTelenor Pakistan Collaborates with NUST Business School on Design Thinking Skills Training49These Three Pakistan Women Are Turning Heads in the AI WorldPakistan’s Climate Startup Fund Faces Setback After Sarmayacar ExitPakistan IT Sector Sees Record Export Growth in FY2024-25Digital Growth Accelerates in Pakistan: IT Exports Hit $2.825B, Yet Startup Ecosystem Faces Capital CrunchUS Tech Fund Commits $10 Million to 2 Pakistani IT EntrepreneursNIC Lahore Startups Make History with Silicon Valley Entry‘Perfect Pitch’ Is Coming! Pakistan’s Startup Scene Set to ExplodeShark Tank Pakistan Faces Scrutiny After Failed DealPakistan Startup BeMe Raises Massive Funding from Village CapitalStartup Founders Can Now Get Rs5m Through NIC Karachi & Orbit ProgramThe Best Productivity Apps for Students and Professionals (2025)Pakistan Investor Summit Day 3: 25+ Startup Pitches at NIC KarachiVoltShare Secures Six-Figure Investment from Canadian InvestorPakistan’s Economic Outlook 2024: Key Insights from the PSER ReportSECP Hosts First-Ever Startup ConferencePakistan’s Startup Ecosystem Shines at NIC’s Connect 2024Pakistani Auto Repair Startup OkayKer Raises $0.7 Million in Seed FundingBazaar Launches Bazaar Prime, its Exclusive Distribution Vertical10 Super Spanish Startups To Look Into 2023AgriTech Startup, VeGrow Farms Gets Significant Funding For its MVPPakistan Just Experienced this Year’s Worst Quarter for Startup Funding: ReportWhy Airlift Collapsed After 18 Months Of Operating Even With $85 Million Funds RaisedGoogle For Startup Accelerator Is Ready To Take 15 Pakistan Start-ups In Its Seventh Version.Pakistan’s First Wealth Management Company Raises $2.1 Million in Pre-Seed RoundCIRCLE partnerships with HBLWomen-led StartupsVivo V60Vivo’sTrukkrYangoAndroid 16 Update Triggers Lock-Screen Problems on Pixel DevicesMobile Phone Manufacturing Rises in Pakistan 2025Samsung Galaxy S26 Ultra Battery and Camera Specs LeakPhones In North Korea Secretly Takes Screenshot Every 5 MinutesTelecom Company Zong Ordered to Return Rs2 Billion to Pakistani UsersElectronics Marketplace PriceOye Raises $7.9 Million from PayPal founder Peter Thiel and OthersPakistan drops to 97th position on the Digital Quality of Life Index 2021Xiaomi’s profits on the rise as Huawei suffers a drop in fortunesXiaomi reaches the top 10 globally in the smartphone marketEarly teasers for Android 12 featuring a fresh UI redesign with security updatesFacebook launched a digital payment system feature in WhatsAppPTA extended the Blocking of IMEIs of unregistered devicesA Telehealth startup combating COVID-19 is planning to take COVID-19 in Pakistan42Decentralised platformMycoWeb3iPhone 16 seriesWhatsApp Zero Click Bug Patched After Targeted Spyware CampaigniPhone Set for Big Design Shifts in the Coming Three YearsApple Debuts Thought-Controlled iPad Tech in Accessibility BreakthroughApple Exploring Tandem OLED Display for Future iPhonesApple Likely to Unveil iPhone 17 Series on This DateApple to Launch Affordable MacBook Powered by iPhone ChipAndroid Users Can Now Edit Messages Sent to iPhones via RCSWhich iPhone Browser Is Good for Longer Battery Life? Find Out Here!New iPhone 17 Leaks Show Apple Logo Has Shifted — Once AgainApple Supercharges Battery Management with iOS 26 FeaturesiPhone 17 lineupReddit useriPhone 17 chargerMakerspace PunjabPITBiPhone 17 Pro lineupiPhone 18 leaksSamsung Trolls Apple on iPhone 17 Launch, Apple Fans Clap Back HardSamsung One UI 8 Stable Update Rollout Schedule LeaksSamsung Galaxy S26 Edge Dummies Reveal Redesigned Camera and Wireless Charging UpgradeSamsung Galaxy S26 Series Leak Reveals New Design and Release TimelineSamsung Puts Tri-Fold Smartphone Into Mass ProductionSamsung’s First 37-Inch ViewFinity S8 Monitor for Ultimate ProductivitySamsung to Launch New Galaxy S25 Model and AI Tablets on September 4Samsung Galaxy Tab S10 Lite Launched with 10.9-Inch Display and 8,000mAh BatterySamsung Galaxy Tab S11 Ultra Leaks With Massive 14.6-Inch ScreenVivo Y50 seriesHuawei Debuts World’s First 100 MW Charging Hub for Electric TrucksHuawei Partners With HEC to Boosts Pakistan’s Digital Education FutureWhat is the Confusion of Huawei License Cancellation by PTA in Pakistan?Huawei EV Battery Boasts 2,000-Mile Range on 5-Minute ChargeHuawei Is Set To Introduce 3nm Chip In 2026Huawei ICT Courses Now Mandatory for FDE Students in Grades 6–10Huawei signs landmark Deal to train 300,000 (3 lac) Pakistani Students in ICT SaqibQualcomm to Launch Snapdragon 8 Elite 5 Globally on September 23Apple Postpones iPhone Air Release in China Over eSIM Approval IssuesApple Opens Pre-Orders for iPhone 17 Series and New iPhone AirTECNO Spark 40 Pro+ Now Available in Pakistan, Featuring MediaTek Helio G200Apple Watch to Get Hypertension Detection with watchOS 26 After FDA ApprovalApple Launched New Watch Series 11, Watch SE 3 and Ultra 3 at 2025 EventApple Unveils iPhone 17 Air, Its Thinnest iPhone Ever at 5.6mmApple Launches AirPods Pro 3 With Built-In Live Translation and Heart Rate TrackingiPhone 17 Specs Add Dual 48 Megapixel Rear Cameras With 2x Lossless ZoomiPhone 17 Pro and Pro Max With Aluminum Body, Bigger Batteries, and 48MPApple Announces iOS 26 & iPadOS 26 Rollout During iPhone 17 Launch Event336Infinix Hot 60iInfinix Hot 60 Pro+Infinix Hot 60Infinix Smart 8Infinix Smart 7 HDInfinix Smart 10 HDSaudi Investors Seek Joint Ventures with Pakistani Snack MakersGovt Plans Amendments to PERA to Boost Industrial Investment# National Savings# World Bank# Rs200 Prize Bond Draw# Foreign investment# Competition Commission of Pakistan (CCP)# water crisis# Interest Rate# Toll plazas Auctioned# FATF# World Bank And PakistanWorld Bank Flags Low Govt Funding for Punjab Water ProjectUS Tariff Cut Opens Door for Higher Pakistan Copper Exports to USWorld Bank Highlights Delay in MoUs for $78M ‘DEEP’ InitiativeSECP Issues Public Scam Alert on MAG Ventures Investment SchemePakistan Inks Historic Oil Deal with U.S., Ending Middle East RelianceAskari Insurance Closes Property Deal Worth Rs432 MillionGovt Approves 50% Export Retention for Chinese Firms in GwadarCCP Mergers Approvals Unlock $50m Foreign Investment in PakistanGovt Set To Slash The National Savings Schemes ReturnsUS Eyes $1 Billion Investment in Pakistan’s Mineral SectorWorld Bank Launches Education, Water Projects in Balochistan With $194m FundingNHA held open Toll Plaza auctions of these citiesRs200 Prize Bond Draw June 2025 Results Released ( With New Tax Rates)Honor’sHonor mobilesMagic V6 foldableMagic8 seriesKarachiSattar BukshStarbucksApple iPhone 17 seriesQualcomm’s Snapdragon 8 Elite Gen 5PTA warns Patched Mobile Phone Users against strict PenaltiesStreet criminals in Karachi profiting from snatched mobile phonesWhat to expect at Apple WWDC 2013Android App – CircleRoot Samsung Galaxy S I9000Samsung Galaxy S Jelly Bean 4.2 ROMAndroid App Suggestion of the Day – Google KeepHTC Sensation 4G ROM – Android Revolution HD 7.2HTC Explorer Jelly Bean ROM [CM 10]10 things I hate about Android5 Windows Phone Apps for learning10 Must Have Android Apps for Students5 Must have Photography Android Apps5 Must Have Windows Phone Apps Before TravellingApple iWatch Design Concepts333334Pakistan Begins Work on Central Bank Digital CurrencySBP Directs Banks to Equip 25% Branches with CDMs by 2028SBP Reserves Increase by $28 Million, Hit $14.30 BillionSBP to Legalize Digital Currencies Under New Bill 2025Pakistan Cuts Rs2.6 Trillion in Public Debt Before MaturitySBP Launches PESIA for Monitoring Overseas Equity InvestmentsUK May Scrap Visa Fees for Skilled WorkersApple saysReddit usersNow You Can Win TECNO SPARK 40 Pro+ This Independence Day Through a Simple ContestJoin TECNO’s Shot on CAMON 2025 – Win $10,000, London Trip & Much MoreSmartphones Overtake Desktop as Mobile Web Usage Hits Historic 64%PTA Delay in Whitelisting Seized 10,000 Smartphones Stalls Major AuctionGovernment Launches Interest Free Smartphone SchemeKarachi Police Uncover Rs50 Million Mobile Smuggling OperationCustoms Officials Seize Smuggled iPhones Worth Millions at Lahore AirportGoogle Announces Lock Screen Widgets for Android 16Nothing Phone 3a Series Set for March 4 Unveiling at MWC 2025Xiaomi 15 Series Launched in Pakistan – Can It Compete with Flagship Apple & Samsung?ChatGPT Introduces Reminder Scheduling and Recurring Task FeaturesWhy Are App Subscription Prices Higher on iPhone Than Android?money launderingpakistan customsIT Sector Leads as SECP Registers Over 3,200 New Companies in August 2025SECP Warns Public Over Illegal 4D Group Investment SchemeSECP Issues New Rules for Digital Asset Management ServicesPakistan’s Loan App Boom: Financial Lifeline or Digital Debt Trap?SECP, SBP Salary Powers Curtailed After Rs41m Pay RowSECP Clarifies Senate Panel’s Objections on AGP’s Irregularities ClaimSECP Issues NBFC Permits to Expand Digital Lending and FDISECP Audit Findings Reveal Unauthorised Salary Hikes and Withheld FundsSECP Launches Infrastructure Mutual Funds FrameworkNAB Distributes Rs3.7 Billion in First Phase of B4U Fraud RecoveryiPhone 17 ProAKD Group Acquires 27% PC Hotels Stake in Major MoveSecure Logistics Gets SECP Nod for Name ChangeImage Pakistan Is Set To Own A Super Luxury UK Fragrance brandMeezan Bank Achieves Historic $2 Billion Market Cap MilestonePhilip Morris Delisting Approved at Rs1,300 Per Share, PSX ConfirmsPakistan’s First Executive Risk Management Forum: Transforming SOEs for Future SuccessPakistan Stock Exchange Hits All-Time HighSupernet Expands Cybersecurity Reach with New Telecom ContractsSystems Limited Suspends Trading on PSX Due to Stock SplitPSX Broke 75 year Record!! Mega Gains After Pakistan-India CeasefirePSX Bloodbath continues as Indian Attack’s Fear growsPSX Plunges 1,400 Points Amid Rising Pakistan-India TensionsPSX Plummets 2500 Pts As Indo-Pak War Clouds DarkenUS Agencies Gain Approval to Use Meta’s Llama AIFederal Govt Notifies Shahid Iqbal Posting to Science and TechnologyFBR Launches Digital Invoicing System to Streamline Sales TaxFBR Launches Informational Campaign for TaxpayersRepeat Offenders May Face FBR E-Invoicing Penalty of up to Rs3mFBR Revenue Shortfall Hits Rs42bn in First Two Months of FY2613iPhone Air in the country has been delayed due to eSIM compliance concernsGovernor SBP Jameel Ahmad Inaugurates JazzCash Experience Lounge in IslamabadGovt Approves Rs3.5b Subsidy for QR-Based PaymentsSBP Projects 3.25–4.25% Growth for Pakistan in FY2026Has Sadapay Introduced Ads On Transaction Screens? Let’s Break it DownPakistan’s Foreign Reserves Rise to $19.6 BillionSBP to Stay Closed on August 14Pakistan’s July Remittances Hit $3.21B, Kicking Off FY26 on Strong NotePakistan Investment Bonds Auction Surpasses Rs300bn TargetSBP Selects Design for New Currency NotesSBP Keeps Monetary Policy Rate Steady at 11%6Pakistan EconomyPakistan oil and gasPoland investmentSazgar Engineering Profitability Doubles in FY2515 PSX Companies Now Hold $1 Billion Market CapitalizationPSX Faces Black Monday as Global Market Collapse Continues After Trump’s Tariff ThreatsPSX Hits All-Time High After Power Tariff ReliefEngro Secures CCP Approval for $563 Million Deal to Acquire Jazz’s Deodar Tower AssetsPakistan Launches First PKR-Denominated Green Bond on PSX to Drive Sustainable FinanceElectrolux and PEL Announce Partnership for Home Appliance Expansion in PakistanZarea Limited Secures Rs1.03 Billion in Pakistan’s First IPO of 2025SBP to Introduce New Currency Notes with Enhanced Security in 2025Air Link’s Subsidiary set to Begin Local Production of Xiaomi TVs in PakistanShell Pakistan Renamed to Wafi Energy Pakistan LimitedInterest RateMonetary Policy RateSBPTreet Battery Enters Lithium-Ion Market with Chinese PartnerNational Savingsprize bondsRs200 Prize Bond DrawSBP Approves UBL Share Split to Boost Market LiquidityShareholders Approve Silkbank-UBL Merger, Awaiting Final ApprovalTop Contributors to PSX’s 84% Surge in 2024Pakistan Receives $300M Loan from UBLPakistani Banks Ordered to Refund Millions to Fraud Victims Following Presidential DecisionPark View Enclave Challenges Silkbank-UBL Merger in Sindh High CourtPakistan Stock Market Surges as 11 More Companies Cross Billion-Dollar ThresholdUBL, NBP, and MCB Bank Lag in Financial Literacy and Sustainability Transparency: FFA ReportUBL and Silk Bank to Finalize Merger Through Share SwapSilkbank Receives Board Approval for Merger with UBLUBL: Spearheading the Digital Banking Revolution in PakistanPriceOye.pk partners with United Bank Limited to provide BNPL payment option to credit card users of UBL# Federal Board of Revenue (FBR)# Budget 2025-26 tax measures# Sales Tax# Income Tax# taxes# Federal governmentPakistan Post Mail Suspension Hits US-Bound Deliveries After New TaxesGovt Unveils Simplified Tax Form for Salaried ClassIslamabad Car Token Tax to Rise Following Cabinet DecisionFBR Ends QR Code Requirement for IRIS LoginFBR Can Now Access Your Internet and Call DataFBR Faces Pressure to Fix Income Tax Return System Ahead of 2025 Filing DeadlineGovt Plans Gradual Cut in Super Tax for Manufacturing SectorFTO Targets Rs133m Fake Tax Invoices ScamElectric BusesSargodha TransportMillat TractorsPSX MTLIRISTaxpayersADBFloodInstallment Scheme for 41,000 E-Bikes, Rickshaws Officially LaunchedScientists Create New Fire Blocker Lithium Battery For EVs, PhonesGlobal EV Sales Hit 1.8M in June, Led by China and EuropeCapital Smart Motors Brings Futuristic JMEV Elight to PakistanKarachi to Welcome 100 EV Charging StationsPunjab to Set Up 2,000 EV Chargers, Roll Out 600 Electric BusesChinese EV Giant Skywell to Establish 75-Acre EV Plant in PunjabHaroon Akhtar Holds Talks with Changan, Suzuki on Auto Sector IssuesPrince Volt EV Now on 0% Interest Plan – Book Now!Chinese Audi Electric Version Launched at Auto Shanghai 2025Dongfeng Box EV in Pakistan Debuts With Long Range and Smart FeaturesFirst Fatal Crash Involving Xiaomi SU7 Sparks Safety Concerns and Stock DeclinePakistan Launches First Fast EV Charging Station, Cuts Charging CostsPunjab Afternoon Schools Upgrade to Cost Rs470 MillionBangladesh Govt Announces 500 Scholarships for Pakistani StudentsPunjab Approves Rs120 Billion for Elevated Expressway Project in LahorePunjab University Declares ‘Zero Week’ as Floods Disrupt RoutineThese Areas in Lahore to Pay Cleanliness Fee From Sept 1Punjab to Implement Second Phase of Teacher Rationalisation PolicyPunjab Workers Flats Scheme Opens for ApplicationsPunjab Free Laptop Scheme Phase 2 Launch for Students10Pakistan, China Strengthen Financial Cooperation 2025PTCL Group Posts 16% Revenue Growth in H1 2025CCP Clears 117 Merger Applications in PakistanCCP Grants 85 Exemption Certificates to Key Industries in PakistanPakistan Enters FY2026 With Lower Inflation, Narrower Deficit# Automobile# Pak Suzuki# auto industry# car prices# Kia Sportage# Kia Sportage L# Kia PakistanEurope July Car Sales Rise Most Since April 2024 as BYD Overtakes TeslaIslamabad Airport Parking Charges Increased for PassengersOverseas Pakistanis Vehicle Registration Gets NADRA BoostGovt Announces 40% Tariff on Used Car ImportsKP Lets Car Owners Keep Custom Registration Number after SaleTribunal Cuts Hyundai Nishat Penalty in Deceptive Marketing CaseOverseas Pakistanis Can Now Buy & Gift Cars Via This Exclusive OfferToyota Global Sales 2025 Reach Record High, Retains Top Automaker SpotPakistan’s First Car Safety Law Sets Huge Fines and Jail Terms for ViolatorsYou Can Now Own a Suzuki GS150 Without Paying Full Price UpfrontSuzuki launches all-in-one Car Insurance for Pakistani DriversPakistan’s Automobile Sales Surge by 46% in FY25Suzuki Wagon R 2025 Unveiled with New FeaturesFact Check: Is the 2025 Suzuki Mehran Making a Comeback?Suzuki Alto Sales Drop by 29% in February Amid Discontinuation SpeculationsNo Ban on Suzuki Alto for Motorways, Confirms Authorities Amid Safety ConcernsPak Suzuki Announces Permanent Suspension of Wagon R BookingsAGTL Records Sharpest Decline with 66% YoY Drop to 410 Units in February 2025Suzuki Leads Pakistan’s Auto Sales in February 2025 with 5,330 Units SoldPak Suzuki Raises Prices of Alto and Ravi, Effective February 25Suzuki Enters EV Market with the Launch of e-ACCESS Electric ScooterIslamabad-RawalpindiRail ProjectPakistan Govt Questions IMF’s Draft Report on Corruption IssuesPakistan Sees 59% Jump in July Foreign InflowsIMF Delegation Visit to Pakistan Set for Next Economic ReviewMoody’s Upgrades Pakistan’s Credit Rating as Economic Reforms Bear FruitGovt to Cut Solar Returns, Offer Surplus Power to IndustriesIMF Rejects Pakistan’s Subsidy Plan for Crypto and Data CentersSBP Buys $6.8B to Boost Reserves, Repay DebtReason Behind Delay in Direct Pakistani Flights to UKPIA Privatisation Expected by NovemberFlight Operations at Sialkot Airport to Resume TodayPIA Shifts Sialkot Flights to Lahore as Floodwater Threatens AirportFlyadeal Launches Low-Cost Flights to PakistanLahore-to-Karachi AirSial Passenger Mistakenly Lands in JeddahTurkish Airlines Set To Expand Flights to PakistanPIA resumes Gulf Flights amid widespread delaysPIA restarts direct Lahore to Paris flights after 5 yearsPIA Announces 15% Off on Lahore-Paris FlightsPakistan Launches AI Wrapper Competition 2025 to Tackle Local ChallengesToyota Hikes Car Prices by Up to Rs. 600,00Toyota Prius 2025 Set to Launch in Pakistan with Up to 40 km/L Fuel EfficiencyToyota Fortuner is Coming Back with a BangToyota Just got more Affordable! Bank Alfalah Launches 0-Stress Financing PlansMeezan Bank is now offering cheaper Toyota Cars till 31st MayA New Toyota EV Model (bz7) Is making wavesToyota Unveils the Hilux Hybrid 48V: Everything You Need to Know About the Toughest Eco-Friendly PickupToyota Set to Launch Third-Gen Hydrogen System for Cars and TrucksNissan Backs Out of Honda Merger Talks, Raising Uncertainty Over Its FutureToyota GR Corolla Gets Performance Upgrade with New Automatic Transmission, Launching March 3Chery and Ghandhara Automobiles Part Ways in Pakistan; Here’s Why?Lahore AdministrationParking FeesTraffic RegulationAGPFederal AccountsTesla Secures Just 600 Orders in India Since July Debut, Reports BloombergJury Holds Tesla Partially Liable in Autopilot Crash LawsuitTesla Unveils Larger Six-Seater Model Y L for ChinaWhy Tesla Model Y is So Expensive in India?Tesla Enters India with Mumbai Launch, Skips Local ManufacturingTesla delivers driverless Model Y to customer to showcase robotaxiTesla V4 Superchargers Go Live in ChinaTesla’s Robotaxi hits the road in AustinTesla’s Robot Optimus Can Now CookTesla to Begin Robotaxi Testing in Austin SoonTesla Revealed $10 million Payments to Powerwall Plants in 2024commitmentsCar ImportsCar SafetyAlsvin Black SerieschanganPakistan’s Exports Stood at $5.11 Billion as Textiles Grew 10% in Early FY26OGDCL Approves $715M Funding for Reko Diq ProjectGold Sees Strong Rally and Hits New PeakNEPRA Cuts Electricity Prices by Rs1.79 per UnitRs25000 Prize Bond Result Announced for September 2025Rs40000 Prize Bond Result Announced for September 2025Pakistan and Türkiye to Boost Agriculture Food and Health CooperationKia Confirms Staggering Price Hikes in Pakistan (All Vehicles)Kia and BYD Pakistan Announce Delivery Delays Amid Highway ProtestsHyundai Announces Official Launch of Tucson Hybrid in Pakistan on April 21, 2025Hyundai Tucson Hybrid Set to Launch in Pakistan: Expected Specs, Price, and MoreKia Introduces Installment Plans for Stonic and Picanto Starting from Rs 56,780 in PakistanKia Motors Launches Exclusive Ramadan OffersKia to Unveil Three New Electric Vehicles at Kia EV Day on February 27, 2025Changan Oshan X7 vs. Kia Sportage FWD; Which One Should You Buy?MG HS PHEV vs Kia Sportage FWD: Which SUV Reigns Supreme?Kia EV9 Makes Its Debut in Pakistan with Cutting-Edge FeaturesKia Sportage L Unveiled in Pakistan: Here’s What You Need to KnowAuto Sales Surge by 54% in July-December Amid Declining Interest RatesKia 5th Gen Sportage Hybrid Spotted in Pakistan; Expected Launch Date Revealed?Auto SalesBISE MultanHSSC-II ResultHBL Microfinance Bank and SUPARCO Partner for Satellite-Based Agri LendingPakistan Services Exports Grow 9.23% in 2025Pakistan Exports First Tractors Consignment to TanzaniaNBP Reports 91% Profit Drop in First 9 Months of 2024FBR Implements Up to 75% Hike in Property Rates Across 56 Pakistani CitiesFBR Revenue Falls Short by Rs. 90 Billion in OctoberKP Government Introduces Life Insurance Program for ResidentsGovernment Moves to Close Tax Loophole for BanksSystems Limited Reports 24% Profit Decline over 9 MonthsRaast Payments Reach Rs1 Trillion in Just 16 DaysTop 9 Business Groups & Companies Transforming Pakistan’s EconomyEight Ex-PIA Employees Awarded Rs 200 Million in Unfair Dismissal CaseSwvl CEO denies shutting down consumer business amid strategic shiftPSEB reports $40 returns for every dollar spent at GITEX GlobalOpenAI’s valuation raises to $157 Billion following latest funding round6667Over 200 FIRs Filed Against Real Estate Firm Bidding on PIAReddit Achieves First Profit in Two Decades with $29.9M Q3 EarningsBISE FaisalabadClass 12thHSSC ExamsBikes productionMotorcycle shutdownYamaha PakistanSamsung Powers the World’s Longest-Range EV With Its Own BatteriesRiddara RD6 Electric Pickup Set to Launch in PakistanPakistan’s NEV Policy 2025–30 Targets 2.2 Million Electric Vehicles by 2030Textile Giant Plans EV Market Move as Operations Stay HaltedBYD Launches Nationwide EV Test Drive in PakistanMercedes-Benz Solar Paint Could Make EVs Run on Pure SunlightHelm.ai Rolls Out New Vision System for Self-Driving CarsMG Car Prices Go Up After New Budget Taxes Take EffectGovt Plans A Hidden Tax for Every Fuel-Based Car Owner in PakistanElectric Taxis Coming to Lahore: Registration Now OpenChery Makes Major Leap in EVs with Solid-State Battery PushEV Price Decrease in Pakistan on the Cards as Govt Finalizes NEV PolicyBISE SahiwalPosition HoldersAll Three Honda Atlas CG125 Models Now Available On InstallmentsPunjab Confirms Electric Buses in Another Major District from October 2025Rawalpindi Announces Schedule for Mobile Driving License VansHonda CG150 Installments 2025 0% Interest with Bank AlfalahHonda ICON-e Electric Scooter Now on 0% InstallmentsNew Asia Launches 4 Ramza Models from Rs155,000 in PakistanHonda City Facelift to Debut in Pakistan Next Week After 4 YearsAtlas Honda Rolls Out Three CG125 2026 Models in PakistanFuel Prices Announced For Next Fortnight, From September 138Massive Rs. 50,000 Subsidy Announced on Crown Electric BikesPunjab Cracks Down on Commercial Vehicles Without Fitness CertificateJMEV Elight Launched in Pakistan with 500KM RangeSuzuki Launches Installment Plan for Alto VXL AGSHonda Faces Backlash in Pakistan Over Aspire S LaunchHonda Unveils First Locally Assembled HR-V e:HEV in Pakistan (Booking Dates announced)Honda Is Shifting Towards Hybrid with Less Focus ON EV’sHonda City 2025 now on 0% markup installments in PakistanAtlas Honda Set to Launch First Electric Bike in Pakistan by June 2025Honda Atlas Cars Reports Rs. 566 Million Profit in 3QMY25, Up 2.95x YoYHonda and Nissan Plan Merger to Rank Third in Global Auto Industry by 2026Three New Honda Models Set to Debut by 2026BYD Pakistan to Launch Country’s First Hybrid PickupBYD Megawatt-Scale Charging Hits 900 Miles in 12 MinutesBYD Reveals Gen4 Blade Home Battery With 29.6 kWh CapacityBYD to Rival Porsche with Bold Denza Z Debut at Auto Shanghai 2025BYD Teases Arrival of Shark 6 Hybrid Pickup in PakistanCharge in a Flash: BYD’s EVs Now Recharge in Just 5 MinutesBYD Launches 2025 Atto 3 Electric Crossover with Updated Features and PricingBYD Begins NEV Deliveries in Pakistan with MMC PartnershipKPT Successfully Handles First Commercial Shipment of BYD Electric Vehicles to PakistanMCPL Takes Major Step in BYD Partnership with 50% Acquisition from HubcoLUMS Reveals Rs463M Cryptocurrency Holdings in Audited Financial ReportFBISE Launches Pakistan Mathematics Olympiad to Foster Talent in MathematicsTikTok Has Announced 18,000 Scholarships for Students in PakistanTikTok, Edkasa and LUMS partner to make PakistanNEPRA Chairman and its CSR award winners visit LUMSBARD Foundation to establish Research Chairs at LUMSLUMS Vice Chancellor named International Educator of the YearCPPA-G and LUMS join hands for capacity building of Power sector entities in Pakistan under the envisaged CTBCM regimeLUMS Commemorates its 35-Year Association with Industry PartnersThis is the only Pakistani university that made it into Asia’s Top 100 this yearNIC at LUMS’ Cohort Seven Brings Social Solutions at Investor Summit21 Pakistani universities feature in Times Higher Education World Rankings 2022National Incubation Center Lahore at LUMS brings Stanford SEED’s SPARK program to PakistanBISE GujranwalaHSSC ResultSenate Committee Examines IT Ministry on AI Law, Flags Issues in Jazz–NUST CollaborationNUST Rocket Team Wins “Most Dedicated Team” at UK’s Mach-25 CompetitionQuaid-e-Azam University, NUST Cinch Top Places in QS Top 500 ListNUST Secures 127th Position in QS Global Rankings 2025 for Engineering and TechnologyFDE Opens Admissions for Islamabad Model Schools & Colleges for 2025-26Govt Approves NUST, NUTECH, and COMSATS University Campuses in KarachiNUST Appoints Lt Gen (R) Zahid Latif to Lead as RectorNUST Achieves Global Recognition with 43 Researchers Among World’s Top 2% ScientistsNCAI Announces Nationwide AI Challenge With Cash Prizes For StudentsNUST Student Develops Intelligent Signals That Prevent Traffic JamsTesla and NUST Collaborates To Level-up Racing EV Production Of FERNNust’s Undergrads Are Making Pakistan’s First Autonomous Dronesrevealed.Sindh Govt, Pakistan Railways Push Ahead on KCR RevivalStep-by-Step Guide to Apply for Sindh Electric Motorcycle SchemeSindh Voluntary Retirement Rules Allow Early Exit with Pension CutsSindh’s Jhimpir Project Aims to Cut Industrial Power CostsSindh Govt Declares Holiday for Schools Across ProvinceSindh Solar Scheme Eligibility Criteria: Who Can Apply?Sindh Abolishes Parking Fees on Public Roads Across KarachiSindh Extends Ajrak Number Plate DeadlineSindh Online Learner License Issuance Crosses 208,000 Mark in Just Nine MonthsBISP Faces Staff Shortage and Service Concerns Amid Rising PovertyVehicle owners in Sindh get more time for Biometric Verification (New Date Confirmed)2025 Liveability Index Gives Damning Verdict on Karachiposition holdersBISE DG KhanPunjab Matric Exams Delayed Again, New Date AnnouncedSchools resume in Punjab and KP; flood-affected institutions stay closedHEC Releases Updated List of Recognised MS, PhD ProgrammesMedical and Educational Facilities are Critically Low in PakistanForeign Boards Expected to Come Under IBCC and Education MinistryNew Sports Facilities in Islamabad Schools to Include Padel Courts and Futsal FieldsUK Becomes First to Add AI as Official School SubjectHow Video Games Are Secretly Teaching Adults CodingPMDC to Decide Fee Structure for Private Medical and Dental CollegesGovt Seeks World Bank Approval to Revise Punjab’s $200M Health and Education PlanTop 10 Metaverse And Web3 Forecasts For 2023HEC Chairman Stresses Upon Using Technology In EducationPAVE PortalBike FinancingBike Scheme 2025Yadea electric bikesChina Offers Support for Pakistan Bullet Train ProjectHonda Atlas Announces Price and Booking Schedule for City Aspire SPunjab Excise Registers Most Expensive Vehicle EverPunjab to Roll Out Electric Taxi Scheme in Two WeeksSazgar Engineering Plan PHEV Tank 500 and Cannon Launch 2026BISE BahawalpurBISE DG Khan 12th Class Result 2025 Top Position Holders AnnouncedBISE Sargodha Board Inter Part-II Result 2025 Toppers AnnouncedEasy Ways to Check Your BISE Punjab Class 12 Result Online!Dates Announced for Class 5 and 8 Board Exams 2026Registration Exam Mandatory for Foreign Medical Graduates: PM&DCBISE RawalpindiCar loan growth hits Rs276.6bn despite financing challengesIslamabad Excise Department fines Rs67,700 in road safety driveSeven Family Members Suffer Critical Injuries in E-Bike Battery ExplosionHyundai Nishat unveils 7th Generation Elantra Hybrid at PAPS 2024Pakistan International Auto Show 2024 Begins with Grand Launch at Lahore Expo CentreFBR Proposes New Amendments and Allows Foreign Tourists to Temporarily Import VehiclesBYD Launches SEAL and Atto 3 in Pakistan; Official Prices and Specifications RevealedSindh Govt to Introduce Online Vehicle Registration and Transfer Services Starting January 2025Changan Lumin EV Ready for Big Reveal at Pakistan Auto Show 2024Pak Suzuki Raises Prices of GS150 and GD110S ModelsSuzuki Every officially launched in Pakistan: Official Price, Features, and MoreChangan offers a limited-time discount on the Oshan X7 in Pakistan; Here’s the new pricingXiaomi cars to be launched in Pakistan?Indus Motor Company Temporarily Stops Production due to Material Scarcity3536MG Unveils Huge Launch Discount on the New HS PHEVHyundai reduces car prices by Rs800,000: Here’s All You Need To Know!Suzuki Reveals Its First All-Electric SUV, the e VITARA, Set for 2025 ReleasePak Suzuki Drops Popular Graphite Grey from Vehicle Lineup in PakistanApple iPhone 16eRs. 245000Apple iPhone 17Rs. 340000Apple iPhone 17 AirRs. 420000Apple iPhone 17 ProRs. 445000Apple iPhone 17 Pro MaxRs. 510000Featured
Infinix Hot 60 ProRs. 59999Upcoming
Vivo Y400 4GRs. 64999Upcoming
Samsung Galaxy S25 FERs. 239999Upcoming
Infinix Hot 60 Pro+Rs. 64999Upcoming
Google Pixel 10Rs. 225999Upcoming
Xiaomi Redmi 15 5GRs. 67999Realme GT 7 Dream AdditionRs. 219999Available
Vivo X Fold5Rs. 569999Upcoming
Tecno Spark 40CRs. 29999Available
Tecno Pova NeoRs. 44799namesSamsung Galaxy S25 Ultra
VS
Apple iPhone 16 Pro MaxGoogle Pixel 9a
VS
Nothing Phone (3a) ProOppo F21 Pro 5G
VS
Vivo V23eXiaomi 15 Ultra
VS
Infinix Note 50 Pro+Samsung Galaxy S24
VS
Apple iPhone 16BISE Kohat Announces HSSC Part I & II Annual Examination Toppers ListPakistan to Introduce AI Education at Primary School LevelHEC Releases Laptop Scheme Merit List for SAU StudentsNo Budget for Promised Free Scooters for Female Teachers6-year-old Pakistani kid becomes the youngest Microsoft PowerPoint ProfessionalPakistan Education Department using FBI-certified forensic-quality fingerprint scanners in rural areasSarwat FatimaGovernment rejects COMSATS’s new projects over allegations of mismanagement and misuse of fundsEngineering students can take a year off to start their own ventures8 facts you should be aware of when applying for universityReport a security bug and get a hefty reward from Google79HEC goes for quantity over quality; plans to set up 5 universities, 36 campuses in next 3 yearsPakistan’s first Massive Open Online Course launches through an IndieGogo CampaignGovernment imposes another tax – this time on Education sectorRohayl Varind, 19, wins World Summit Youth Award 2014Huawei, Pakistan Signs Key IT MoUs at Pakistan-China B2B ConferenceKP College Privatization Plan to Hand Over 55 Public InstitutionsPakistani University Shines in Global Innovation Rankings 2025MoITT Partners with HEC, Meta & NCEAC to Launch National AI Faculty Upskilling InitiativePakistani Government Invests Rs. 1.97B in UK-Based ScholarshipsGovt Allocates Rs. 61.1B to HEC for 159 University ProjectsLaw-GAT Test rescheduled, Roll Number Slips ReissuedHuawei’s Training Initiative Set to Equip 60,000 Pakistanis with Advanced IT Skills by 2025Govt Unveils Groundbreaking E-Sports Plan for PakistanUSAID Funding Halt Threatens Education of 530 Pakistani Students Amid Scholarship CrisisFunding Crisis Hits Islamabad’s Federally Chartered UniversitiesHEC Updates Curricula for Political Science, Islamic Studies, Remote Sensing & GIS, and ArchitectureBISE Mardan Website Restored After Crash During Matric Result 2025 ReleaseBISE Mardan Matric Result 2025 Declared!BISE Swat Matric Result 2025 Announced!BISE Mardan Matric Result 2025 Date, Time ConfirmedBISE Abbottabad Class 9th Result 2025 Declared!BISE Lahore Announces 2025 Matric Exam Rechecking ScheduleSamsung Galaxy Tab S10 FE+Samsung Galaxy Tab S10 FESamsung Galaxy Tab S10 UltraSamsung Galaxy Tab S10+Apple iPad mini (2024)Apple iPad Pro 13 (2024)Apple iPad Pro 12.9 (2021)Apple iPad Pro 11 (2021)Xiaomi Pad 7 ProTecno MegapadInfinix XpadHuawei MatePad SE 1125NextXiaomi Redmi 15C 4GXiaomi Redmi 15 5GXiaomi Redmi 15 4GXiaomi 15S ProXiaomi Civi 5 ProXiaomi Redmi Turbo 4 ProVivo V60 5GVivo Y400 5GVivo Y400 ProVivo Y400 4GVivo X Fold5Vivo iQOO Z10 Turbo ProrevealedBISE SargodhaMotorola Moto G86 PowerMotorola Moto G86Motorola Moto G56Motorola Edge (2025)Motorola Edge 60 ProMotorola Edge 60Apple MacBook Pro (M3 Max 14-Core) – 16 inch, 30 Core GPUApple MacBook Pro (M3 Max 12-Core) – 16 inch, 18 Core GPUApple MacBook Pro (M3 Pro 12-Core) – 16 inch, 18 Core GPUApple MacBook Pro (M3 Max 14-Core) – 14 inch, 30 Core GPUApple MacBook Pro (M3 Max 16-Core) – 16 inch, 40 Core GPUApple MacBook Pro (M3 Pro 12-Core) – 14 inch, 18 Core GPUtop positionLenovo ThinkPad X1 Carbon Gen 11 (Intel Core™ i7) – 14 inchLenovo ThinkPad E14 Gen 6 (AMD Ryzen™ 5) -14 inchLenovo ThinkPad X1 Carbon Gen 12 (Intel Core™ Ultra 5) – 14 inchLenovo ThinkPad P14s Gen 5 (AMD Ryzen™ 7) – 14 inchLenovo ThinkPad E16 Gen 2 (Intel Core™ Ultra 7) – 16 inchLenovo ThinkPad E16 Gen 2 (AMD Ryzen™ 5) – 16 inchBISE Punjab 12th Class Result 2025 Date ConfirmedGovt Announces Scholarships for Employees’ ChildrenIBCC Announces Türkiye Visit Program for Matric ToppersFBISE Unveils New Model Examination CentresGovt Launches Free Courses for Overseas Pakistanis’ ChildrenPunjab Govt Hikes School Fees Under PEF from Sept 2025Saeed Book Bank Reopens After FBR Sealing in IslamabadKarachi Opens 100 Community Schools for Slum ChildrenPunjab Sets Uniform School Holidays Following LHC OrderPunjab Makes Teaching License Mandatory for All TeachersRealme 15 ProRealme 15Realme C25YRealme Narzo 80 LiteRealme C73Oppo Reno14 FOppo A5 4GOppo A5x 4GOppo Reno14 ProOppo Reno14Oppo Find X8 UltraTecno Spark 40Honor X9c17Samsung Galaxy S25 FESamsung Galaxy S22 Ultra 5GSamsung Galaxy S25 EdgeSamsung Galaxy XCover7 ProSamsung Galaxy F16Samsung Galaxy F06 5GApple MacBook Pro (M3 Pro 11-Core) – 14 inch, 14 Core GPUAcer Predator Helios Neo 16 (Intel Core™ i7) – 16 inchAcer Predator Helios Neo 14 (Intel Core™ Ultra 7) – 14 inchAcer Predator Helios Neo 16 (Intel Core™ i9) – 16 inchAcer Predator Helios 18 (Intel Core™ i9) – 18 inchAcer Predator Helios 16 (Intel Core™ i9) – 16 inchAcer Nitro 5 (Intel Core™ i7) – 15 inchAcer Predator Helios 300 (Intel Core™ i7) – 15 inchAcer Nitro V 16 (AMD Ryzen™ 7) – 16 inchAcer Predator Helios Neo 14 (Intel Core™ Ultra 9) – 14 inchAcer Nitro V 15 (Intel Core™ i7) – 15 inchAcer Nitro V 15 (Intel Core™ i9) – 15 inchAcer Nitro V 15 (Intel Core™ i5) – 15 inchOppo Find X8s+Samsung Galaxy F56ZTE Blade A76ZTE nubia RedMagic 10SPro+ZTE nubia RedMagic 10S ProZTE nubia Z70S UltraZTE nubia RedMagic 10 AirZTE nubia Focus 2 UltraHuawei Pura 80 UltraHuawei Pura 80 Pro+Huawei Pura 80 ProHuawei Pura 80Huawei Nova Y73Huawei nova 14 UltraTecno Spark 40CTecno Spark 30 ProTecno Camon 30 PremierAcer Aspire 3 (AMD Ryzen™ 5) – 14 inchLenovo ThinkPad X1 Carbon Gen 13 (Intel Core™ Ultra 7) – 14 inch, Aura EditionAcer Aspire 3 (AMD Ryzen™ 5) – 15 inchSamsung Galaxy S25+Samsung Galaxy Z Flip7Samsung Galaxy Z Fold7Samsung Galaxy A36 5GSamsung Galaxy A16Samsung Galaxy A06Samsung Galaxy A25Samsung Galaxy A15Samsung Galaxy A05sSamsung Galaxy A05Samsung Galaxy A54 5GXiaomi Redmi Note 14Xiaomi Redmi Note 14 5GRedmi Note 13 4GXiaomi Redmi 14CXiaomi Redmi Note 14 Pro 5GRedmi Note 13 ProXiaomi Redmi 13Xiaomi Redmi A5 4GXiaomi Redmi 14C 5GInfinix Smart 10Infinix Smart 9Infinix Smart 9 HDInfinix Hot 50iInfinix Hot 50Infinix Hot 50 Pro 4GLenovo Phab PlusLenovo Phab2Lenovo Z6Lenovo Phab2 PlusLenovo A6 NoteLenovo s5Lenovo K12 ProLenovo S60Lenovo K12Lenovo A5000Lenovo A8 2020Lenovo A7000Vivo iQOO Z10RVivo Y19s ProVivo X200 FEVivo V50 Lite 5GVivo V50 LiteVivo V50Apple iPhone 16Apple iPhone 14Apple iPhone 11 ProApple iPhone 12 Pro MaxOppo A5 ProOppo A3Oppo A3xOppo A80Oppo A60Xiaomi Redmi Pad SEXiaomi Redmi Pad SE 8.7Xiaomi Poco PadXiaomi Pad 6Xiaomi Redmi Pad ProXiaomi Pad 7ASUS Vivobook Go 15 (Intel Core™ i3) – 15 inchASUS Vivobook Go 15 (Intel Pentium) – 15 inchASUS Vivobook Go 14 (AMD Ryzen™ 5) – 14 inchASUS Vivobook Go 15 (AMD Ryzen™ 5) – 15 inchASUS Vivobook Pro 15 OLED (Intel Core™ Ultra 9) – 15 inchASUS Vivobook Pro 16X OLED (Intel Core™ i9) – 16 inchASUS Vivobook Pro 15 (Intel Core™ Ultra 9) – 15 inchASUS Zenbook Duo (Intel Core™ Ultra 9) – 14 inchASUS Zenbook S 13 OLED (Intel Core™ i7) – 13 inchASUS Zenbook S14 (Intel Core™ Ultra 7) – 14 inchASUS Zenbook S16 (AMD Ryzen™ AI 9) – 16 inchSamsung Galaxy Tab A9Samsung Galaxy Tab A9+Samsung Galaxy Tab A7 LiteSamsung Galaxy Tab S6 Lite (2022)Samsung Galaxy Tab S8+Samsung Galaxy Tab S9 FE+Samsung Galaxy Tab S9 FESamsung Galaxy Tab A8 10.5 (2021)How to Make Money Blogging in 2025 (A WordPress & BlogSpot Guide)From Idea to Launch: A Complete Guide to Starting a Dropshipping Business Is Your CV Getting You Rejected? Here is a Step-by-Step Fix The Home Chef’s Guide to Starting a Successful Online Food Business (2025) Read MoreThe Complete Guide to Company Registration in Pakistan (2025) read moreThe Strategic Guide to Effective English Learning Study Abroad for Free: Your Guide to International ScholarshipsFinding Your Fit: A Step-by-Step Guide to the Right Career Path A Step-by-Step Guide: Learn with DigiSkills, Earn as a FreelancerHow to Pass Your ICAP Exams: A Complete Guide to Strategy & SuccessHow to Choose a Rewarding Career in Pakistan: A Practical Self-Analysis Guide A Complete Guide to Starting Your Tajweed JourneyLenovo ThinkPad T14 Gen 4 (Intel Core™ i5) – 14 inchLenovo ThinkPad E16 Gen 2 (AMD Ryzen™ 7) – 16 inchLenovo ThinkPad X1 Carbon Gen 11 (Intel Core™ i5) – 14 inchLenovo ThinkPad X1 Carbon Gen 12 (Intel Core™ Ultra 7) – 14 inchLenovo Legion 7i Gen 9 (Intel Core™ i9) – 16 inch, with RTX™ 4070HP OMEN Gaming 16t (Intel Core™ i7) – 16 inchHP OMEN Gaming 16 (Intel Core™ i7) – 16 inchHP OMEN Gaming 17z (AMD Ryzen™ 5) – 17 inchHP OMEN MAX Gaming 16t (Intel Core™ Ultra 7) – 16 inchHP Pavilion Plus 14 (Intel Core™ Ultra 5) – 14 inchHP Pavilion x360 2-in-1 (Intel Core™ 3) – 14 inchHP Pavilion 16t (Intel Core™ 7) -16 inchHP OmniBook Ultra Flip 2-in-1 Next Gen AI (Intel Core™ Ultra 5) – 14 inchHP Pavilion 16 (Intel Core™ Ultra 7) – 16 inchHP OmniBook Ultra Next Gen AI (AMD Ryzen™ AI 9) – 14 inchHP OmniBook Ultra Flip 14 (Intel Core™ Ultra 7) – 14 inchHP OmniBook Ultra 14 (AMD Ryzen™ AI 9) – 14 inchGoogle Pixel 10 Pro FoldGoogle Pixel 10Google Pixel 10 Pro XLGoogle Pixel 10 ProGoogle Pixel 6Google Pixel 7Google Pixel 6 ProGoogle Pixel 7 ProGoogle Pixel 5Google Pixel 9aGoogle Pixel 9 ProGoogle Pixel 9 Pro XLDarazSMEDAUpworkFiverrShopifyYouTubeTikTokZoomSkypeEtsyGoogle TrendsFacebookWixGumroadSeedoutBOPSecurities and Exchange Commission of Pakistan (SECP)WaveMailchimpLinkedInQuickbooksCanvaTrelloGoogle DocsBufferNBP Official WebsiteNBP Digital AppStandard Chartered Bank Credit Card Process Made Easy (2025 Guide)Getting a MCB Credit Card: Your Comprehensive GuideEverything You Need to Know About Getting Meezan Bank Debit Cards in 2025Here’s How You Can Get A UBL Credit Card Easily in 2025How to Get Your Car Lease Approved in Pakistan (2025 Guide)Streamline Your Tax Process: How to Verify Your NTN Online Today How to Choose the Best Health Insurance Plan in Pakistan (2025 Guide)Huawei nova 14 ProHuawei nova 14Huawei Nova Y72SHuawei Nova Y63Huawei Enjoy 80Huawei Mate XT UltimateChainanalysis’ 2021 Global Crypto Adoption Indexcrypto adoption in the countryHassan AhmedApple iPad (2025)Apple iPad Pro 11 (2024)Apple iPad Air 11 (2025)Apple iPad mini (2021)Apple iPad 10Apple iPad Air 5Dell Pro Max 14 (Intel Core™ Ultra 7) – 14 inchDell Pro Max 14 (Intel Core™ Ultra 5) – 14 inchDell Pro Max 16 (Intel Core™ Ultra 7) – 16 inchDell Pro Max 16 (Intel Core™ Ultra 5) – 16 inchDell Pro 13 Plus (AMD Ryzen™ 7 PRO AI) – 13 inchDell Pro 13 Plus 2-in-1 (AMD Ryzen™ 5 PRO) – 13 inchDell Pro 13 Plus 2-in-1 (AMD Ryzen™ 5) – 13 inchDell Pro 14 Plus 2-in-1 (AMD Ryzen™ 7 PRO AI) – 14 inchDell Pro 14 Plus 2-in-1 (AMD Ryzen™ 5 PRO) – 14 inchDell Pro 14 Plus 2-in-1 (AMD Ryzen™ 5) – 14 inchDell Pro 16 Plus (AMD Ryzen™ 7 PRO AI) – 16 inchDell Pro 16 Plus (AMD Ryzen™ 5 PRO) – 16 inchDon’t Buy a Used Phone Without Checking the Battery: Here’s HowStop Your Laptop from Overheating: A Guide to Cleaning Fans and VentsThe Ultimate Guide to Smartphone Security and Hack Prevention A Practical Guide to Saving YouTube Videos for Offline ViewingThe Complete Guide to Renaming Your Facebook Page How to Reinstall Windows 10 and 8: A Step-by-Step GuideHow to Find Hidden Cameras and Listening Devices in Your HomeCarry the Quran in Your Pocket: A Guide to the Best Quran Reading Apps How to File an Online Complaint with PTCL: A Step-by-Step GuideStatisticaEasy DIY Slime: A Step-by-Step Guide for Fun, Stretchy Slime The Ultimate Guide to Calorie Counting for Pakistani CuisineHow To Make Coffee: A Complete Guide For Every Coffee Lover Healthy & Delicious: How to Enjoy Pakistani Food Guilt-FreeFeeling Overwhelmed? A Practical Guide to Handling Workplace StressHow to Edit Your Selfies Like a Pro – A Beginner’s GuideThe Best Apps for Watching Live TV in Pakistan (2025 Guide) How to Beat the Airlines: Your Ultimate Guide to Cheap FlightsHow To Find The Best Clothing Deals For EidThe Ultimate Car Checklist Before a Long Road TripHow to Develop New Habits and Skills Without Leaving Your Home The Ultimate Guide to Managing Your Utility Bills OnlineHow To Lose Weight In Ramadan: A Comprehensive Guide A Beginner’s Guide to Buying Groceries Online in PakistanHow To Reap Maximum Health Benefits Through Fastinghttps://www.google.com/android/find/aboutSBP Approves LemFi-UBL Partnership for RemittancesHyundai to Reintroduce 6th Gen Elantra in PakistanPakistan Crypto Council Engages Trump’s Adviser to Boost Digital AssetsXRP Price Plunges 4% As Analysts Predict Rebound After Key Market ShiftInvestors Question Whether Bitcoin is Exhausted As the Coin Dips to $109KBitcoin Nears $110K as Crypto Market Faces CorrectionPakistan Funds PVARA to Regulate CryptocurrencyRafiq LightwalaPakistan’s very first tax assistant appInvestify Stocks freeInvestify Stocks ProiPhone 17 Series Now Available in Pakistan with 0% InstallmentsMuhammad HaarisHuawei Nova Flip S Tipped to Launch Soon, with New ChipsetApple iPhone 17 Series PTA Prices Announced in PakistanApple Plans Higher iPhone 17 Production Amid Strong Pro Model DemandNCCIA Exposes 139 Platforms Selling Citizens’ DataSialkot’s Forward Sports Crafts FIFA World Cup 2026 Ball ‘Trionda’Elon Musk’s Call for Netflix Boycott Over Content Reservations Sends ShockwavesReddit Users Complain About Mobile Networks for Unwanted Service ActivationsOpenAI Acquires Roi to Advance Personalized Consumer AISindh Introduces Strict Traffic Fines Up to Rs100,000Snapchat Moves to Paid Storage Model, Limits Free Memories to 5GBPunjab Launches Mobile Vans for Easy Driving LicensesHonda Brings Limited-Time Free Registration Offer for HR-V e:HEVHarvard Team Builds First Continuously Operating Quantum ComputerSerene Air Grounded: CAA Suspends Airline for Failing Safety StandardsFortnite x Poppy Playtime: Huggy Wuggy Creeps Into the IslandHonda Bikes Now Available on Easy Installments with 0% MarkupBitcoin Price Hits Record High Above $125,000Discord Hit by Third-Party Breach; User Data and ID Images LeakedNADRA Removes Fee for CNIC Cancellation After DeathPunjab Govt Fully Digitizes Civil Secretariat with e-Filing SystemHere’s What Pakistanis Need to Know about the First Supermoon of 2025Electric CarsBentley’s First Electric SUV Spotted Testing Ahead of 2026 LaunchPM&DC Cuts License Processing Time to Four DaysPunjab Approves Rs20,000 Per Acre Aid for Farmers Hit by FloodsJeff Bezos Makes Bold Space Colonization PredictionStablecoin Market Surges to $300B, Boosts Crypto RallyNCERT Issues Red Alert on SAP NetWeaver VulnerabilitiesMicrosoft Wants You to Save the World By Using Bing Instead of GooglePakistan Still Struggles to Stop Illegal Sale of Citizens’ Data on the Dark WebSamsung Drops Surprise XR Headset Reveal at Qualcomm Summit 2025Pakistan to Launch 5G in Seven Major Cities SoonPSX Maintains Bullish Momentum on IMF Review, RatingsCCP Approves Merger of Global Haly with Bank MakramahUBL Becomes First Pakistani Bank to Hit Rs.1 Trillion CapPaapam Warns IMF Trade Liberalisation Risks Auto SectorApple 2025 Roadmap: New iPad Pro, Apple TV, Vision ProPTCL–Telenor Merger Gets CCP Nod, Rivals Assess Market ImpactPTCL–Telenor Deal Moves Forward with CCP’s Tightest Compliance MandatesCCP Examines PTCL’s Bid to Buy Telenor Pakistan in Major Industry MergerT-Mobile Expands Satellite Service With WhatsApp, Google Maps, and XMeta Launches Instagram Map in Pakistan with Privacy40 New Electric Buses Join Lahore Fleet under Phase IIPunjab Issues Fresh Smog Guidelines for SchoolsTrump Moves to Curb Foreign Enrolment at US UniversitiesFour UK Universities to Open Campuses in PunjabPunjab CM Approves Cleanliness Initiative for SchoolchildrenHow to Get Sora 2 Invite Code on iOS Right NowDeepfake Political Ads Surge on Meta, Security Watchdogs WarnCardiff Band Furious As Their AI Clone Beats Them on Spotify StreamsOpenAI Valuation Hits $500b After $6.6b Employee Share SaleOpinionsSaqib AhmedBeing your own bossPlan 9 Tech IncubatorIBA CEDLCEMicrosoft Innovation CenterNESTIOMIT Enterprise Forum PakistanPasha FundDotZeroSEED VenturesArpaTechCloud9VenExelJumpStartCoin SetterP&G’s Exit: A Headline, not a HarbingerZeeshan AhmedPathfinder CITADEL’s Startup Challenge Offers Routes to World Economic Forum 2026 StageNIC Peshawar Hosts KP Investor Summit & Graduation Ceremony for Cohort 12 StartupsChina Wants to Challenge NVIDIA’s AI Chip DominancePunjab Govt Announces Rs. 100 Million Reward for Top 100 SchoolsChery to Locally Assemble Hybrid Vehicles in PakistanWorld’s First Driverless Electric Rickshaw Unveiled in IndiaDaraz Pakistan Prepares for 10.10 Mega Sale with Official Launches From Sony, Philips, LG & Top Global and Local BrandsWorld Bank Projects 2.6% GDP Growth for Pakistan in FY2025-26Capcom Explains Simultaneous Launch of Three Resident Evil Titles on Nintendo Switch 2IESCO, NADRA Introduce Biometric Verification for New Electricity ConnectionsHEC Chairman Appointment Delayed Due to NITB Job Portal GlitchFlydubai Introduces New Power Bank Rules for Flight SafetyForeign Investors Urges FBR to Clear Rs96.6bn in Pending Tax RefundsBSEK Confirms Expected Date for 9th Class (SSC Part I) Result AnnouncementPTA Warns Indian Spy Network Uses Fake Job Offers to Steal Pakistani DataOne Health Symposium at COMSATS Unites Global Experts to Tackle Climate-Linked Health ChallengesPakistan to Get Advanced US AMRAAM MissilesDefense Ministry Acts Against Fake Weather AccountsSenate Orders Private Schools to Cut Unjustified FeesBitcoin Faces Key Test at $124K After Record HighAMD and OpenAI Form Alliance to Boost Global AI CapacityUS Scientists Win Nobel Prize in Physics for Quantum BreakthroughsNCERT Issues Phishing Alert Against Scam Calls and MessagesGoogle’s Play Store Appeal Dismissed by US Supreme CourtOver 12,400 Youth Join Punjab’s Global IT Certification InitiativeTesla Set to Launch Affordable Model Y to Revive SalesPunjab Launches AI System to Fight Smog and Improve Air QualityPCAA Releases 2025 PAK Airline Rankings: Two New Airlines on the LeadRewterzRewterz Threat Intelligenceblog postDataPakistanprivacy breachtopHEC Delays USAT, HAT, and AML-CFT Tests Amid Security ConcernsOEC Announces Saudi Arabia Jobs for Pakistani Medical Professionals3G/4G Services Suspended in Islamabad and RawalpindiIHC Grants Relief to Drivers Without LicensesPunjab Revenue Authority Collects Rs66.41 Billion in Q1, Up 28%Over 600 Pakistani Firms Registered in China, Expanding Trade and E-Commerce PresenceSaudi Arabia to Introduce Sugar-Based Taxation System in 2026Metro Bus, Orange Line Train Suspended Amid Security ConcernsPunjab Launches Pakistan’s First AI EcoBot for Real-Time Air Quality MonitoringOpenAI’s Sora App Tops 1 Million Downloads in Under Five DaysApple Raises Bug Bounty to $2 Million to Fight Spyware ThreatsPUBG Mobile Introduces “Winter Mode” With Snow, Slippery Terrain & Gameplay TwistsMicrosoft OneDrive Upgrade Brings New Windows App and an AI Photo AgentValve’s Next VR Headset Enters Mass Production, Eyes 500K Units This YearPakistan’s Real Economy Could Be Close to $1 Trillion: Finance MinisterPunjab Revenue Authority’s Tax Collection Jumps 28pc Year-on-YearPakistan-Origin Startup Founder Takes On Big Tech With Bold Distributed Cloud VisionMade-in-Pakistan Cars Reach 20 Countries with Record ExportsHow A Pakistani Startup Is Helping the Deaf Community Through Tech and EmpathyBitcoin Falls Below $120K, Analysts Expect Quick ReboundUniversity of Peshawar Under Fire for Posting AI-Written News Without EditsSpotify Connects with ChatGPT for Smarter PlaylistsKSE-100 Drops 0.87% Amid Profit-Taking, MoUs SupportMeta Upgrades Facebook Reels with Fresh Algorithm and Instagram-Like FeaturesPakistan’s Car Sales Jump 53% as Suzuki Leads RecoveryGoogle Search AI Mode Now Available in Multiple LanguagesSBP Injects PKR 3.3 Trillion to Stabilize LiquidityAmazon Kuiper to Launch Satellite Internet in PakistanPakistan’s Internet Crisis in 2025: Among the Slowest and Most Expensive in the RegionTamperedChef Malware Still Spreading Despite NCERT’s WarningGovt Moves Forward with First Women Bank Limited PrivatisationBISP Spent Rs2.73 Billion on Consultants Over Five YearsiPhone Fold Leak Reveals Mixed Materials Design and New iOS FeaturesHyperOS 3.0: Which Xiaomi Devices Will NOT Get The UpdateSamsung Unveils New 200MP ISOCELL HP5 Sensor Featuring the World’s Smallest PixelsSamsung Galaxy S26 Ultra Leak Shows Apple-Like Orange ColorSamsung Expands Android 16 One UI 8 Rollout to Four More Galaxy PhonesGovernment Admits Internet Connectivity Failures in Islamabad, Urges Temporary FixesIT Ministry Yet to Approve MVNO Framework Despite One-Year DelayWateen Telecom to Pay Rs2.2bn in Dues as LDI Disputes Drag OnPTA Website Revamped: Improved Accessibility and Urdu SupportOngoing 5G Spectrum Battles Push Back 5G Plans and Hurts Network PerformanceYouTube Launches ‘Second Chance’ Program for Banned CreatorsSnapchat Tests 3D Bitmoji Plaza on Web for Shared Avatar SpacesLinkedIn Limits Free Competitor Tracking to One Slot Under New Analytics PolicySindh Police to Relaunch E-Challan System on October 27Hyundai Expands Sedan Lineup with Elantra Limited Edition 2.0 in PakistanIBCC to Introduce Digital Reforms in Exams with Automation and E-MarkingTimes World University Rankings 2026: 48 Pakistani Universities FeaturedFBISE Introduces New 10-Tier Grading System Starting with 2026 ExamsFBISE Announces New Minimum Passing Marks for SSC and HSSCOpenAI Expands ChatGPT Go Plan to 16 Asian CountriesChinese Researchers Use AI to Explain Convergent Evolution in SpeciesMusk’s xAI Nears $20B Capital Raise, Structured Around NVIDIA ChipsThe Great AI Feedback Loop: Innovation or Imminent Bubble?Pakistan, Saudi Arabia Partner to Empower Youth Through ITPM&DC Approves 5% Fee Hike for Medical and Dental CollegesPak Suzuki Announces Exciting Cash Bonus for Every VX BuyersBitcoin Struggles at $110K After $20B Crypto Liquidation WipeoutZeekr Luxury EVs Launch in Pakistan by Capital Smart MotorsCapital Smart Motors Launches Six Electric Vehicles in PakistanAliExpress Adds Heavy Taxes for Pakistani Buyers Despite Tax RollbackSindh Approves Pakistan’s First University Science & Tech ParkPakistan’s Startup Funding Plunges to $15.2 Million in Q3 2025Xiaomi 17 Ultra Leak Hints at 200MP Camera with Major UpgradesSamsung’s Next Flagship Phones Could Run on the World’s First 2nm ChipVivo Y21d Announced in Pakistan at an Affordable PriceSamar Jafri Named Spotify RADAR Pakistan Artist for Q4 2025Facebook to Shut Down Gaming Creator ProgramInstagram Tests New Layout Prioritizing Reels & DMs in Home Tab RedesignCM Maryam Nawaz to Launch Electric Bus Service in Rawalpindi on Oct 15Honda ICON-e Electric Scooter Now Available with 0% Interest InstallmentsSindh Govt Announces Promotions for Teachers & School EmployeesPakistan’s National AI Policy 2025: Goals, Strategy and Big ImpactChatGPT Brings More Affordable GPT-5 Access to Pakistani UsersInternet Down, Frustration Up: Why It’s Always the First to Fall?NCCIA Busts Online Job Scam Network in MultanSindh Approves 500 Electric Buses for Karachi and Hyderabad2,050Dubai Expands Golden Visa to Private School Teachers and EducatorsPTC Targets Rs65 Per Share with Telenor Pakistan Acquisition GainsGoogle Brings Pehla Qadam Bootcamp to Pakistan’s Thriving Tech SceneGoogle Rolls Out Free One-Year AI Pro Plan for Students in PakistanSouth Korea Doubles Job Quota for Skilled Pakistani Workers in 2025Saudi Prince Mansour Bin Mohammed Al Saud to Acquire Majority Stake in K-ElectricFortnite Adds Doja Cat “Mother of Thorns” Boss: Here’s Where to Find HerSaudi Arabia to Launch AI Hub in Pakistan This OctoberGoogle Chrome’s New Feature will Disable Web Notifications AutomaticallyPolymorphic Malware Quietly Slips Past Security Defenses, Experts Sound AlarmMicrosoft’s Copilot for Windows Gains Gmail Integration and Office File SupportPTA Warns of AI-Powered Cyberattacks Targeting Pakistan’s Telecom SectorMicrosoft Responds to Next-Gen Xbox Cancellation RumorsEU Grills Apple, Snapchat, YouTube Over Child Safety RisksPunjab Farmers to Get Rs30m Interest-Free Loans for High-Tech MachineryPakistan Govt Likely to Delay 5G Spectrum Auction to Early 2026Discord Data Breach Exposes 70,000 Users’ ID PhotosApple Leak Reveals Reference to “Dual Knit Band” for Vision Pro Next GenerationCDA Approves Smart Water Metering Project for Islamabad562Google Opens Gemini CLI to Developers with Powerful New Extensions SystemAI Unexpectedly Powering a Hiring and Office Boom in Silicon ValleyAI Is Increasingly Revolutionizing How Humans Start Businesses: Here’s What We KnowGoogle Gemini 2.5 Launches With Human-Like Computer Use AbilitiesUS Approves Resumption of Nvidia Chip Exports to UAEAnthropic Opens First India Office to Expand AI Presence in AsiaGoogle Expands Opal AI App Builder to 15 More Countries Including PakistanChatGPT Enters the Courtroom: Legal Battles Without LawyersMeta’s New AI Can Learn Physics, “Surprise” Itself When Reality Breaks59Homegrown Startups Shine at NIC Islamabad Investors Summit 2025121OPPO A6 ProWhen Will Apple Reveal Details About Its October Event?OnePlus 15 full Specs and Design Leak Ahead of Global LaunchHyperOS 3.0.17.0 Update to the Xiaomi 17 Pro SeriesMotorola to Rival Samsung, Apple in Smartphone Slimness RaceApple Releases Second Developer Beta of iOS 26.1 and iPadOS 26.1Google Pixel 11 May Finally Switch to MediaTek Modem for Faster 5G339Pakistan and Saudi Arabia Set Sights on CPEC-Style Economic Corridor After Defense PactRs 750 Prize Bond Draw Date Announced for October 2025KSB to Build Major Engineering Factory in PakistanPakistani Banks Outshine Asia-Pacific Rivals in Q3 2025Gold Prices Hold Steady in Pakistan After Hitting World Record# EconomyGovt to Engage Global Experts for Faster SOE PrivatisationPakistan’s Remittances Jump 11.3% Year-on-Year to $3.2 BillionPakistan to Privatise 82% Stake in First Women BankPakistan to Introduce New Licensing Policy for Business ChambersSaudi Trade Delegation Explores New Investment Avenues in Pakistan76Sindh Govt Approves 16.5 KM Karachi Expressway to Ease TrafficFerrari Reveals Tech for Its First Electric Car ElettricaCM Punjab E-Taxi Scheme 2025 Balloting UpdateHyundai Elantra 2.0 Special Edition Launching Soon# Electric BusesJMEV Elight Price in Pakistan RevealedPakistan’s Auto Sector Revs Up with 53% Sales Surge in Q1 FY26Lahore’s Orange Line Metro Train Gets Major UpgradeJAC T9 FRISON 2X Debuts in Pakistan with Competitive PricingIndus Motor Company Eyes Used Car Imports After Policy Shift90% of Pakistan’s E-Bikes Use Unsafe Lead BatteriesPunjab Govt Plans to Reduce Syllabus for Matric and Other ClassesAll 30 Sindh Districts to Get IT CollegesPunjab Schools Face Funding Shortage Due to Budget DelayHEC Launches Fully Funded PhD Program at Top 300 US UniversitiesPunjab Expands Free School Meals to 10 DistrictsPunjab Approves Full Scholarships for Top Students Across ProvinceLahore Students Barred from Matric Exam for Being Late84Available
Samsung Galaxy F14 4GRs. 23,905Meizu Mblu 22 ProRs. 38,999Honor X6cRs. 29,999Available
Realme C75xRs. 34,899Available
Tecno camon 11 proRs. 27,999Available
Honor X9cRs. 99,999Available
ZTE Axon 60 LiteRs. 55,999Available
Vivo Y300Rs. 79,999Available
Google Pixel 6Rs. 106,999Motorola Moto G84 5GRs. 66,899Available
Apple iPhone 17 Pro MaxRs. 473,000Available
Apple iPhone 17 ProRs. 520,500Available
Apple iPhone 17 AirRs. 480,000Available
Apple iPhone 17Rs. 399,000Available
OPPO A6 ProRs. 74,999Available
Tecno Spark 40CRs. 26,999Crypto Sees Massive Liquidations: $7.5B Gone in One HourXRP, DOGE, SOL Slip as $2.7B Flows into Bitcoin ETFs Amid Profit-TakingBitcoin Falls Below $120K Amid Bearish Market PressureMassive Bitcoin Whale Transfer Causes Buzz in the Crypto MarketsEA App Glitch Breaks Battlefield 6 Launch: EA Offers CompensationStandard Chartered BankCAA Temporarily Allows SereneAir to Resume Flights in Saudi ArabiaArmor King Roars Back in Tekken 8 After Season 2 BacklashBattlefield 6 Shatters Steam Records: 747,000 Players at LaunchOverwatch 2 Revamps Mythic Skins: Full Unlocks at Tier 1On design, leaks claimFoldable PhonesHuawei nova Flip S58AnalystsCitizen PrivacyNCCIAPTA BlockSportsFIFAFIFA World Cup 2026Made in PakistanCricketPSL Franchises Reject Gambling Deals Worth MillionsAli Tareen Slams PCB’s ‘Victory Lap’ Over PSL X, Cites Plummeting Fan EngagementBabar Azam Joins Three time Big Bash’s Champion Team For S15pic.twitter.com/DstKHfuqeqOctober 1, 2025https://t.co/K0ZLCbWHHoNetflixNetflix’s New Fantasy Blockbuster Becomes the First to Hit 266M ViewsSplit-Release Backfires? ‘Wednesday’ Season 2 Struggles On Global Rankings5 Movies You Can Stream This August Weekend To Kill TimeThese mobile network providers need to be taken to court.u/snoop_sandmanpakistanRedditInstant CheckoutRoi AppSindh TrafficTraffic Lawscompany announcedmobile appsSnapchatMobile VansPunjab LicensesHonda PakistanHybrid carsNatureQuantum ComputerAre Smart Glasses Going to be the New U.S.-China Tech Tussle?CAASereneAirGameRantpic.twitter.com/r7hzFRe4N6October 3, 2025Epic GamesFortnite collabsFortnitemares 2025Horror Video GamesCCP Slams Steel Giants with Record PKR 1.50 Billion FineSNGPL Announces Gas Schedule for Islamabad LocalitySenate Panel Begins Inquiry into Pakistan Steel Mills CrisisIslamabad High Court Bars FIRs Against Drivers Without Licenses‘Over 450,000 Jobs Lost Due to Privatisation in Pakistan’Punjab Deploys Anti-Smog Squads Across Lahore to Combat PollutionPunjab Launches Project to Build 57,000 Affordable Homes for Low-Income FamiliesNADRA Expands Overseas Services with New Counters in 4 CountriesFESCO Revises Smart Meter Connection Rates for 2025857Telecom Companies Prohibited from Sharing User DataLDI Operators Face Scrutiny for Non-Payment of License ChargesGovt Dismisses Allegations of Poor Internet Connectivity in BalochistanIslamabad to Get Free WiFi at 30 Locations by December 2025Telenor Asia Welcomes CCP Approval of PTCL-Telenor Merger, Awaits PTA NodCCP Approves PTCL–Telenor Merger with Strict Conditions64Meta Might Be Considering Algorithm-Free Timelines for Facebook and InstagramCourt Extends Interim Bail for Ducky Bhai’s Wife Until October 23WhatsApp is About to Bring Username Reservation Feature to AndroidInstagram Has A Clever Way to Reward & Celebrate Creative TalentIndonesia Restores TikTok License After Platform Shares Data on ProtestsTikTok Updates Age Detection & Safety Tools as Concern Over Youth Use GrowsSpotify Partners with OpenAI to Bring ChatGPT-Powered Music Discovery173Dogecoin Flashes Bullish Signal, $1 Target AheadBinance Coin Rockets to $1,300, Overtakes XRP & Tether in Crypto RankingsCrypto Stocks Rally After Bitcoin Reaches $125K Once MoreCan Solana Outperform Ethereum with ETF Approval?These Three Altcoins Have All the Power to Go Ballistic Before 2026Analysts Say “Next Leg” Has Begun As Bitcoin Eyes $150K & ETF Inflows73# iOS 26# Spark 40 SeriesiPhone 17e: Everything We Know About Apple’s Next Budget iPhoneTen Pakistani Startups Unveil Innovation at Expand North Star 2025Pakistan Pavilion Debuts at Expand North Star 2025, Showcases Tech & StartupsFaysal Bank Offers Electric Bikes from Rs. 7,146/MonthCement Sector Profits to Rise 34% in Q1FY26Punjab Education Foundation Teachers Await Salary Raise Amid Government DelayHarassment Allegations Rock Karachi Matric BoardSaudi Investors Eye Seven Key Sectors in PunjabAltcoins Bounce Back as Broad Crypto Market Stabilizes Post U.S.-China UncertaintyGold and Silver Prices in Pakistan Hit Historic Highs Amid Global Market RallyTapmad Expands to Bangladesh: Partnership with GrameenphoneToyota Offers 25% Off Wheel Alignment for All BrandsNVIDIA-Backed Reflection AI Raises $2B, Valuation Jumps to $8BSindh Issues Alert Over Fake Pink Scooty Scheme OnlineAvatar: The Last Airbender Fighting Game Set to Launch in 2026Punjab Govt to Solarize 355 Public CollegesAtlas HondaHonda bikesPunjab Raises Penalties for Delayed Vehicle Ownership TransferHow to Check PAVE e-Balloting Results OnlineGovt Launches Cost Sharing Scheme for e-Bikes and RickshawsSindh Govt Announces Pink e-Bikes Distribution for WomenCrypto Fundraising Hits $3.5B Record as Bitcoin Peaks Before Market CrashConfirmed: Pakistan to Face Internet Shutdown on October 14 Due to Cable MaintenancePakistani AI Fintech Metric–Max CF-AI Signs $12M Deal with Nabta HealthNIC Karachi Welcomes 32 Startups to Cohort 14 for Pakistan’s Innovation GrowthPTCL Announces Submarine Cable Maintenance, Internet May Slow DownSenate Committee Reviews Major Foreign-Funded Projects, Highlights Irregularities and Calls for AccountabilityPunjab Plans Electric Bus Network Linking Four Major Cities to Ease TrafficOppo Reno15 Pro Max Specifications Surface Ahead of LaunchPakistan Fertilizer Sector Profits Likely to Fall 20% YoY in 3Q2025; Market Weight MaintainedNational CERT Alerts on Severe Cisco ASA Firewall Vulnerabilities Allowing Remote Code ExecutionPakistan Faces Another Internet and Social Media OutagePakistan Banking Sector 3QCY25 Earnings Preview: NBP, UBL Lead GrowthAre Islamabad and Rawalpindi Getting a Three-Day Local Holiday? Here’s the TruthsourcesDiscordReport Suggests TikTok Post Frequency is Directly Related to Organic Traffic BoostScientists Harness Batteries’ Own Energy to Recover 95% of Key MetalsImmune System Research Earns 2025 Nobel Prize in MedicineScientists Find A New, Sleek Way for Solar Panels to Work Better & Cheaper# Quantum Physics# swedenSUPARCO Advances Space-Based Solutions for Disaster PreparednessScientists Develop Stretchable Light-Emitting Material That Can Transform PhotonicsPakistan Launches First Skin Bank at PIMS to Advance Burn TreatmentBentleyBritish AutomakersElectric SUVRawalpindi Electric Buses to Run on Five RoutesBYD Megawatt Charging Technology Delivers 400 KM in 5 MinutesGovt Announces Eligibility and Installments for Electric Bikes, RickshawsHyundai-LG EV Battery Plant in US Hit by ICE RaidPSX Bloodbath: KSE-100 Crashes Over 4,600 PointsBitcoinBitcoin marketbitcoin priceBitcoin Regains Strength at $112,000 Following Trade War JittersConfirmed: Pakistan to Face Internet Slowdown on October 14 Due to Cable MaintenanceFarmingPunjab FloodsGovt Pushes SME Formalisation Initiative to Boost Small BusinessesCivil SecretariatDigital governanceWindows 10 Reaches End of Support—Here’s How to Keep It Running Securely for Free# Electric Cars# EV# EVs# Elon Musk# Electric SUVGovt Opens Registration for E-Bikes Scheme 2025Punjab Finalizes Cost Plan for E-Taxi ServiceLahore Electric Tram Service to Launch Within Six MonthsPakistan’s First Electric Tram in Lahore Completes Test RunNishat Group Electric Vehicles Set for Launch with China’s Chery PartnershipPunjab Electric Bus Service to Roll Out with Surprising FareIslamabad Electric Trams Set to Hit Capital Roads SoonLahore Launches First ever Electric Tram Project with Chinese-Made UnitNishat Power Eyes EV Future with Major Stake in NexGen AutoNational CERTSAP SecurityIslamabad Police Launches App to Help You Report Crimes InstantlyProject MoohanXR HeadsetApple’s Next AirPods Could Get Built-in Cameras, AI & a Supercharged H3 Chip# Finance MinisterCCP Approves Systems Limited’s Acquisition of BAT SAA ServicesTrump Admin Ends Clean Energy Projects, Freezes Billions in New YorkFM Aurangzeb Confirms Pakistan’s $500m Eurobond RepaymentFinance Ministry Announces Timely Repayment of $500M Eurobond by PakistanADB Projects 3% GDP Growth for Pakistan in FY2026Philip Morris Announces Voluntary Delisting from PSXPakistanis Brace for Another Hike in Electricity BillsArtistic Denim Mills Posts Rs451 Million Loss in FY25Gul Ahmed Textile Mills Announces Closure of Export Apparel SegmentAfter CCP’s Approval, PTCL-Telenor Merger Decision Reaches PTAEthereumTechjuiceCrypto MarketStablecoinBank MakramahBanking sectorCCP mergerCNICSaturnSUPARCOSupermoonmarket rumoursVision Pro headsetMacBook ProApple RoadmapApple TVVision ProUsama AsgharVivo Pakistan Reveals Updated Smartphone Prices for 2025Xiaomi 17 Ultra Moves Closer to Launch with Direct Satellite ConnectionApple Gears Up for October Launch Featuring New M5 Chip DevicesSodium Batteries(PTCL) moves to acquire Telenor PakistanIslamabad, Rawalpindi Resume Normalcy with Internet and M-2 ReopeningDental LicenseMedical CollegesPunjab University Postpones October 13 ExamsRawalpindi Educational Institutions Partially ReopenIMF reviewPSXtrade deficitPhase ICM PunjabElectric BusTrade reformsJeff BezosSpace ColonizationMobile Internet Services Begin Restoring in Islamabad, RawalpindiUK UniversitiesWindows LatestBingAI Scamsdeepfakes5G LaunchDigital GrowthPTA ReportUS UniversitiesWhite HouseNew Rust-Based Malware “ChaosBot” Uses Discord Channels to Hijack PCsAustralian Airline Data Breach Exposes 5.7m Customer RecordsDigital BankingMarket capUBLSeptember 30, 2025rise of AI-generated musicAI-Generated MusicspotifyAlexandr Wangthe CCP highlighted concerns over market concentrationT-MobileTwitterPunjab Education DepartmentPunjab SchoolsSmogPunjab EducationChatGPT ProOpenAI LaunchSora Access3GDrone Smugglers Caught in Major CNF Crackdown Across Lahore DivisionAirSial Expands Gulf Network with New Direct FlightsPunjab Moves Closer to Launching its Own AirlineNCCIA Deputy Director Abducted in Islamabad; Police Launch InvestigationPakistani Students Get a Chance to Study in Japan With Full Funding at University of TokyoHuawei Nova Flip S Announced: Upgraded Battery, Larger Cover Screen, and Premium DesignSamsung Set to Reveal Its First Trifold Smartphone at APEC Summit 2025Open-Source Tech Promises Cheaper, Faster AI Chip DevelopmentRed Magic 11 Pro Launched Featuring Snapdragon Elite Gen 5 ChipsetRiot Just Broke Valorant: Patch 11.08 Flips the Game on Its HeadOnePlus Pad 2 Debuts Soon with Dimensity 9400+ Chip and 3K ScreenPunjab Strengthens Security in Public and Private Schools Across ProvinceWhatsApp Introduces New Message Limits to Tackle Spam and Mass MessagingiPhone 17 Pro Users Experience Finish Discoloration Within Weeks of UseDebunking Myths About Undersea Internet Cable Repairs: Lessons from Pakistan’s Internet SlowdownInside India’s Digital Narrative Machine: The Online Battle for Kashmir’s Story# experts# guest# featured# Wonder App of the WeekWhy the World Is Sleeping On Top Tech Talent From PakistanBreaking Barriers, Bridging Futures: The Digital Rise of Women in PakistanDigital Gender Inclusion in Pakistan: Challenges, Opportunities, and InitiativesZaib-un-Nisa GharshinGoogle Engineer Claims That ChatGPT And Bard Will Lose Against Small AI CompetitorsMeet Aqsa Kausar, The First Google Machine Learning Expert In PakistanHow Windows 10 Is Better Than Windows 11 For General UseStudent Sneaks In Mobile Phone In His Pouch With Pens Wallpaper In Exams To CheatPolitical Instability Highly Affecting Tech Exports Of Pakistan; Estimate Drops From $3B to $2.5BMicrosoft Weak Security Causes Potential Ransomeware Threats To EveryoneCM Approves 513 Hybrid Buses For Lahore Mass TransitChinese Couple Punish Son For Watching TV By Forcing Him To Watch TV All-nightSouth Punjab Police Demand Rs.5B From Government To Stop Gang Operation In AreaRussia’s Google Is Ceasing Operations in Russia Due To Russia-Ukrain WarTaazi – the legal Pakistani music download serviceE-Banking 2015 Pakistan Conference – Projected size of Cards Market in 2017 is $822 billionTroll – Long Lasting Effects of Bullying Illustrated through the Spoken Word5 TV Shows for Geeks and Mortals AlikeEatOye offers Rs. 2 Crore in Discounts to Customers, Starting Today!Take your personal brand to the next level with Twitter AnalyticsPower Banks – What you need to know?!How RemoteInterview.io is changing the way we hireHow Community Building Can Help StartupsIncubators for DummiesCan Technology help fight against terrorism?ListsHow A Pakistani Citizen is Turning Pakistan’s Traffic Nightmares into A Community LifelineMeezan Bank Profit Down 10% in 9MFY25Bank Islami Pakistan Profit Falls 50% in 9MFY25Gold and Silver Prices in Pakistan Today, 24th October, 2025Google Launches Massive Free Online Learning Platform with Nearly 3,000 Tech CoursesVivo V60 Lite 5G — Your Travel Portrait Perfect PartnerTrump Pardons Changpeng Zhao, the Convicted Founder of BinanceAir Link Reports 88% Profit Surge to Rs. 1.58 Billion in Q1 FY26Anthropic’s Claude Partners with Google Cloud in a Historic AI DealYouTube Introduces Daily Time Limit for Shorts in An Effort to Curb Endless ScrollingAlibaba Unveils $660 AI Glasses and ChatGPT-Like AssistantWhy ChatGPT Atlas Browser from OpenAI is Not the Best Thing YetMico AI: Microsoft Introduces Modern Clippy Bringing Life to CopilotPunjab Announces Winter Vacation 2025 Schedule for All SchoolsUzair AhmedLUMS Center for Entrepreneurship (LCE)http://goo.gl/G8kDtDhttp://goo.gl/3uR3hEhttp://goo.gl/qPkcghNADRA to Open Pakistan’s Largest 24/7 Mega Centre in Major CityWomen in Punjab to Get Driving Licenses at Their DoorstepHarmonyOS 6 Public Beta now Live, Huawei Confirms Supported DevicesIs October 27 a Public Holiday in Pakistan?FDIMultinational companiesP&GPathfinder CITADELP@SHAPathfinder CitadelWorld Economic ForumSaudi Arabia Bets Big on VR: Over $1 Billion Invested in Magic LeapGoogle Launches Key Role in Pakistan to Fuel Developer Ecosystem GrowthReddit Takes Legal Action Against Perplexity AI, Other Data ScrapersGoogle’s “Willow” Quantum Chip Advances Verifiable Quantum AdvantageYouTube Shares Key Details on Reinstating Previously Banned ChannelsDubizzle Group Delays IPO Amid Volatile UAE Listing EnvironmentGoogle “Pehla Qadam”: Here’s What Went Down At The Inaugural Bootcamp in LahoreAsia’s Stock Exchanges Push Back on Listed Firms Accumulating Crypto Assets88KP Investor SummitNIC PeshawarIgnite National Technology FundNIC HyderabadUnilever Pakistan Reports Rs4.57bn Profit in 9MFY25India Restricts Officials Authorized to Order Internet TakedownsOctopus Digital Profit Plunges 94.53% Amid Rising CostsHBL Profit Rises as Bank Cuts Provisioning CostsFBR and IMF Agree to Cut Pakistan’s Tax Collection TargetIndustries and Farmers Get Electricity Relief PackagePunjab Govt Launches Rs12bn Plan to Boost English Language SkillsKarachi Consumers Push Energy Ministry for AccountabilityUAE Clarifies No Visa Ban on PakistanGovt Plans $13bn ‘Sea-to-Steel’ Corridor to Revive Pakistan Steel Mills106cash rewardEducation PolicyKarachi University Offers German Course for Rs. 5,000Punjab Launches Teacher Verification & Licensing ProgramPunjab University Offers Free Python Coding ClassesCheryPort QasimJAECOO J7 PHEV Officially Launched in PakistanNishat Motors to Launch JAECOO J7 PHEV in Pakistan TodayWorld’s First AI-Driven F1 Car Debuts in UAEDriverless RickshawElectric VehicleEV InnovationPakistan to Save $1 Billion Annually with Electric Vehicle ShiftJAECOO J7 vs. HAVAL H6: Pakistan’s Mid-Size PHEV SUV ShowdownAudi Puts ChatGPT Inside Your Car with the New myAudi AppFederal Tax Ombudsman Takes Major Decision on Smuggled VehiclesPress ReleasesThe IoT Power Play! PTCL Group Supercharges Pakistan’s Industrial IoT Revolution with Vodafone’s Next Gen IoT Core Platform at GITEX Global 2025Government Briefed on Modern Energy-Saving Models by National Transmission & Dispatch CompanyPTCL Group, CEQUENS Ink MoU for CPaaS Partnership at GITEX 2025Pakistan GDPResident Evil 7Resident Evil VillageResident Evil: RequiemFortnite’s Next Big Move: Customizable Companion Styles Leak Ahead of UpdatePakistan to Launch National Esports Policy: But Is That Necessary?Resident Evil Zero Remake: Guardians of the Galaxy Actor InvolvedCEGA Launches Free Unreal Engine Training Under MoITT & IgniteIESCOHECNITBemiratesflydubaiPower BankHonor Magic 8 Series Officially Goes on Sale in ChinaApple Scales Back iPhone Air Production by 80% After Disappointing DemandApple’s Future iPhones May Include Foldable and Flip DesignsApple May Skip iPhone 19 and Jump Straight to iPhone 20Procter & Gamble’s (P&G) recent exit from PakistanForeign InvestorsTax RefundsNEPRA Slashes K-Electric Tariffs and Tightens Loss TargetsLanda Bazaar Faces Price Shock After Government’s New Clothing TaxSalaried Class Now Pays 29% of Pakistan’s Income TaxBSEKSSC Part-IPAA Dismisses $850,000 Crypto Theft Claims at Karachi AirportIsrael-based spy agenciesCyber AttackData StealingCybercrime in Pakistan Surges 35% Amid WhatsApp Hacking, Digital FraudGoogle Issues Emergency Fix for 3.5 Billion Chrome Users: Here’s What You Should DoAI-Powered Ransomware Wave Sweeps APAC, Exploiting VPNs and Cloud WeaknessesAWS Outage May Trigger Surge in Phishing Attacks, Experts WarnBrand VoiceExceptionally Intact Dinosaur Egg Discovered in ArgentinaGoogle Plans Major Multitasking Boost for TabletsGoogle Chrome Emergency Update Fixes Critical Security FlawOver 60 Nations Sign UN Cybercrime Treaty Amid Global Rights ConcernsGovt Reopens New Gas Connections After Four-Year BanIslamabad Goes Cashless with CDA’s New Digital One-Window SystemPunjab Govt Revises School Hours as Smog WorsensMillions at Risk as JazzCash, Easypaisa Accounts Face Biometric DeadlineGold and Silver Prices in Pakistan Today, 26th October, 2025Punjab to Digitize 38 Toll Plazas Across 24 Districts for Transparent Revenue CollectionPakistan’s Dream for Local Semiconductor Industry Growth Gains Momentum with Saudi CollaborationTelenor Pakistan Launches WhatsApp-Based SIM and Service Management Solution for Seamless Connectivity NationwideNepra Fines Lesco Rs25 Millions Over Power Losses, Poor RecoveryANSESANSES Franceclimate change in pakistanCOMSATS UniversityPublic healthPunjab Announces Rs. 65,000 Stipend for College InternsKMU Declares MDCAT 2025 Results, 53% Candidates Qualify for MBBSUniversity of Peshawar to Shut Nine BS Departments Over Low EnrolmentPunjab Announces Revised Winter Timings for SchoolsAir Link Communication Profit Soars 88% on Expanding MarginsKSE-100 Falls Amid Rollover Week Volatility, Corporate Earnings UncertaintyRupee Gains Slightly Against Dollar, Shows Mixed Global TrendApple Reportedly Adding Vapor Chamber Cooling to 2027 iPad ProOnePlus 15 and Ace 6 Set to Launch with Massive Batteries and 165Hz DisplaysSaudi Arabia Extends $1B Oil Facility, Rolls Over $5B Deposits for PakistanPunjab Launches Drone Policing, Cracks Down on Illegal ArmsXiaomi Begins Global Rollout of HyperOS 3Mutual Fund Assets in Pakistan Cross Rs4 TrillionTraffic Police Outline New Routes for Kachehri Chowk ReconstructionPakistan Railways Abolishes Contractor System for Lahore Station PortersDatta–Kotkay Bypass to Link Karakoram Highway With Tourist RoutesCDA to Launch Two New Electric Bus Routes in IslamabadDefense CooperationPakistan-USNHA Proposes Renaming Islamabad’s T-Chowk to Potohar ChowkPakistan to Close Its Airspace for Two DaysRDA to Launch Online Housing Scheme Verification PortalDGIP Denies Changes to Pakistan Passport DesignGovernment to Resume Islamabad–Tehran–Istanbul Freight Train From December 31Punjab to Suspend Token Tax Defaulters’ Car RegistrationsKarachi Launches Faceless E-Challan System With Heavy FinesDefense MinistryWeather RegulationtechjuiceBitcoin Surges Past $115K: $370 Million in Shorts Wiped Out, Altcoins BreakoutBitcoin Surges to $112,000 on Soft US CPI Data as S&P 500 Hits Record HighPi Network Unveils Big Leap Toward DeFi Future: Can It Deliver?AMDOpenAI Developing AI Music Tool Capable of Generating Soundtracks From PromptsMeta AI Urdu Goes Live in PakistanOpenAI Turns ChatGPT into a Workplace Search EngineFBR Explores AI-Powered Video Analytics to Replace Track and Trace SystemNobel PrizeswedenNASA Confirms Existence of a Second “Temporary Moon” Orbiting EarthData Centres Turn to Old Jet Engines to Power AI’s Soaring Energy DemandsCyber ScamPhishing AttacksPakistan Security Standards Now Mandatory for Cybersecurity ComplianceCyber Threats Surge in Gaming Industry: DDoS, Data Theft and Money Laundering Take Centre StageHow to Protect Yourself from Latest Massive Gmail Data LeakMajor Overhaul Planned as Alleged Cybercrime Mafia Exposed in NCCIAPlay StoreDigital TrainingPunjab Youth ProgramElectric VehiclesEV MarketTeslaAI MonitoringPunjab EnvironmentSmog Controldata published by PCAAPAK AirlinePCAAprivate schoolsPrivate SchoolGerman road traffic agency discovers software glitch affecting thousands of TeslasPakistan’s exports to the US increase by 23%Govt approves IT Park project worth Rs1bn for University of BalochistanPakistan’s tech exports witness sharp 27% drop in May 2022Valorant plans to monitor users’ voice chats, testing to begin next monthGoogle to shut down Hangouts in November as it moves to Google ChatKazakhstan envoy calls on science & tech minister to discuss bilateral cooperationNetflix lays off over 300 employees after subscriber declinePM emphasizes use of modern tech in the mining sectorSTZA to launch special tech zones in SindhPTA denies “speculations” that it is implementing a centralized DNSHBL becomes the first Pakistani bank to provide payment services on WhatsAppiOS 26.1 Update Reintroduces ‘Slide to Unlock’ Style Alarm ControlMicrosoft’s Latest Windows 11 Update Enables Bluetooth Audio SharingGold and Silver Prices in Pakistan Today, 2nd November, 2025Punjab School Timing Violations to Bring Fines Up to Rs1 MillionXiaomi’s Next Redmi Phone Could Feature 9,000 mAh BatteryRs52000 AMR Meter Demand Shocks IESCO Solar UsersVivo X300 Ultra Set for Global Launch with Dual 200MP CamerasPakistan’s Bilal Bin Saqib Named Among Top Global Crypto LeadersPunjab Education Authority Declared Three-Day Closure for SchoolsElectric Tram Project in Lahore PostponedPM Meets Global AI Leader Emad Mostaque to Discuss Pakistan’s AI RoadmapApple Q4 Revenue Tops $102.5B as Tim Cook Confirms AI-Driven Siri Launch in 2026Google Adds AI-Generated Review Summaries to Play StoreKarachi Speed Limit Announced Across Major RoadsIndia Satellite Launch Marks Country’s Heaviest Communication Mission YetOverseas Pakistanis Gain Digital Access to Vehicle Registration and TransfersPakistan Aims for 5.7% Growth Under New 3-Year Economic and Export PlanApple Intelligence Is About to Rewrite Siri’s Future, But Not in the Way You’d ExpectGlobal Commodity Prices Forecast to Reach Six-Year Low in 2026How to Cancel or Pause Your YouTube TV SubscriptionSuzuki Every Discount Introduced as Price Reduced by Rs350,000Social Media Users in Pakistan Rise to 51.6 Million as Facebook LeadsTech Giant Oracle Hit by a Lawsuit That Accuses the Company of Stealing Data of 5 Billion PeopleAlarming report suggests Android users’ data is being sold to the US governmentA team of Pakistani researchers discovers secret data sharing by 16 Facebook appsFord has made a year’s worth of self-driving car data publicly availableTaha Abdullah115 Million Pakistani Mobile Users Data Go on Sale on Dark Web, claims cybersec companyFacebook to pay up to $5 billion fine in FTC privacy investigationReddit’s data is breached & it is asking users to change passwordsAqsa KhunshanFacebook, Google & Microsoft use dark patterns to manipulate their usersGoogle launches new ad settings page to personalize your adsApple bans Developers from sharing user’s informationThousands of Apple users’ data leaked by this high in demand teen appMetro SuspensionOver 30,000 Hybrid Cars Help Pakistan Save $27 Million in Fuel ImportsPunjab Makes EV Chargers Mandatory at All New Petrol Pumps to Boost Clean TransportPakistan Railways Issues New Train Schedule for Lahore and Faisalabad RoutesMinistry of Interior and Narcotics ControlPakistan Telecom Authority (PTA)Will Pakistan Get a Public Holiday for Iqbal Day 2025?October 9, 2025SoraApple Advances Photo Editing AI with Human-Like PrecisionSamsung to Supply Next-Gen HBM4 Chips to Nvidia: Talks Ongoingaccording to the dataWindows appScientists Develop AI-Powered Artificial Muscles That Mimic Human Strengthe-commercePak-ChinaMorgan Stanley Predicts Gold Hitting $4,500 per Ounce by Mid-2026Air Quality Indexclimate changeGoogle Begins Rolling Out Gemini for Home in the USWhat is Dark Web And How You Can Safely Access It in 2025Hackers Allege Steam Data Breach, Data Sold on Dark Web: Here’s how you can be protected8 Year Old Boy in Netherlands Orders AK-47 From Dark WebDarkBERT AI Can Fight Cyber Crimes: Trained On The Dark WebCar maker Ferrari Gets Hit by Cybetattack: Hackers Demanding RansomFederal Government Issues Dark Web Advisors to Ministries and Provincial GovernmentsDark Web Marketplace ‘BidenCash’ Leaks Over 1M Credit Cards1 million Kashmir University Students & Teachers’ Data ‘hacked, put on sale’ on Dark WebSpaceX engineer found guilty of selling insider information on the dark webPunjab Revenue Authoritytax collectionTax Returns Hit Rs. 5.9 Million: No More Blanket Extension for Filers@howbabaofficial#howbaba#howesports❤#pubgmobile#pubgmnextstarprogram#pubgmobilec7s20#pubgupdate#pubgachievements♬ nhạc nền – PUBG Mobile VNPoppy Playtime Chapter 5 Teaser Drops: New Character Coming?Halo 2 & 3 Remakes Reportedly in the Works After Halo 1 RemakeFortnite x The Simpsons Mini-Season Brings Loads of Exciting StuffBattlefield 6 Players Slam Blackwell Fields Map Poor DesignGoogle collects 10 times more data than Facebook and then sells it to the highest bidderMohammad JamalPakistan’s recorded economy stands at $411 billionFinance MinisterFinance Division Under Fire for Missing Details on Rs3.3bn IMF FundsMedical JobsnursesSaudi ArabiaPRAtax reformsGCCBug BountyHackersSpywareLegacy Linux Flaw CVE-2024-1086 Drives Resurgence of Ransomware AttacksPTA Warns Public About Rising Online Job and SIM Card ScamsMajor Microsoft Azure Outage Disrupts Aviation, Banking, Gaming Services GloballyFBR Denies Cyberattack Claims Amid Rising Data Security Concernsnow deleted WeChat postpic.twitter.com/xO4PJop1WqValveAMD Ends Full Support for RX 6000 GPUs: A Risky Move That Could Hand NVIDIA the Win?WhatsApp Begins Testing Companion App for Apple WatchGoogle’s Abandoned Modular Phone Project Resurfaces in TikTok Prototype RevealSamsung Galaxy Buds3 Series Is Getting a New Software UpdateSUNOConnectHearUfone 4GIgnite Brings Pakistan’s Top Startups to TechCrunch Disrupt 2025Pakistan Startup Fund (PSF) Set to Launch at NIC IslamabadPakistani Workspace Startup COLABS Gears Up for Major Expansion into Saudi ArabiaPakistani-Origin London Founder Wins Dragons’ Deal to Power Inclusive Educational GamingPakistan Railways Launches Upgraded Railcar on Major RouteKarachi Imposes Rs20,000 Fine for Driving Without LicenseGovt to Launch National Data Exchange Layer Pilot Phase in DecemberStrict Action Announced Against Men Using Pink Scooters in SindhIs Pakistan Hiding a Nuclear Test? Trump Thinks SoPakistan Inflation Hits 1-Year High at 6.2% in October 2025FBR Targets Flashy Influencer CEO Over Flaunting Undeclared Luxury CarsFauji Cement Joins KAPCO in Major 84% Attock Cement BuyoutPM Shehbaz to Decide Rs170B ADB Road Project Fate SoonGoogle Awards $100K for Two Critical Chrome VulnerabilitiesAir Karachi Confirms Launch Date for Its First Domestic FlightNCERT Issues Urgent Alert on VMware Vulnerabilities in Enterprise and Cloud SystemsRealme C85 Pro and C85 5G Launch With 6.8-Inch Displays and 45W Fast ChargingSpotifyAI IntegrationGoogle Ends Clock App Support for Non-Pixel Wear OS WatchesPTA Opens Bidding Process for Fortiweb Firewall License RenewalFrance Unleashes Drone-Mounted Laser “Painter” That Could Redefine Modern Strike WarfareGoogle’s Full Icon Refresh: Photos and Maps Join Gradient RedesignPakistan Could Earn Over $2 Billion Annually Via Carbon TradingPunjab Imposes Heavy Fines to Combat Lahore’s Rising Air PollutionWorld Bank Calls for Key Trade and Exchange Rate Reforms in PakistanPewDiePie Builds AI “Council” Chat System That Lets Bots Vote on AnswersNew Leak Reveals Samsung Galaxy S26 Unpacked Event DateIslamabad Driving License Campaign Introduces On the Spot Learner PermitsBalochistan Launches 10-Month IT Program for Young TalentKarachi Traffic Police Face Backlash After Officer Caught Violating E-Challan RulesCCP Urges Major Overhaul of Pakistan’s Steel SectorTakedown 2025: Rising Stars Shake Up Pakistan’s Tekken SceneHonda Atlas Fails to Block CCP Inquiry as LHC Upholds Regulator’s AuthorityKia Stonic EX+ Now Available with Shariah-Compliant EMI PlanUsed Car Import Schemes for Overseas Pakistanis Under IMF ScrutinyGovt Enforces Vehicle Safety Standards for All CarsSazgar to Enter Three New International Marketsauto exportsIslamic bankingFortnite Leak Hints at Major Harry Potter Collaboration in Chapter 7DGIP Issues Alert Over Fake Google Maps Passport Office ListingAI MisuseUniversity of PeshawarFederal Board Announces Urdu International Exam ScheduleSindh MDCAT Result 2025 ReleasedEthereum Faces Risk of Drop Below $3,000 as ETF Demand WeakensGoogle Offers to Set Up Chromebook Factory in PunjabRupee Extends Winning Streak, Gains for 28th Straight Day Against US DollarVivo Y19s 5G Unveiled with 6,000mAh Battery and IP64 ProtectionGovt Abolishes 54,000 Jobs to Save Rs. 56 Billion Under Right-Sizing PlanRealme GT8 Pro Flaunts a Sleek Aston Martin F1-Inspired DesignKarachi Traffic Police Offers Major Discounts on E-Challan FinesGovt Orders Independent Audit of Cashless Economy InitiativePakistan’s Digital Payments Surge as SBP Releases FY25 Payment Systems ReviewRawalpindi to Get Rs. 1.2 Billion Mega Parking PlazaGovt Plans to Exit Power Purchase Business and Eliminate Circular DebtInfostealer MalwarePTA Invites New Bids for Fortiweb Firewall License RenewalcompanyInstagram Unveils ‘Competitive Insights’ to Help Creators Benchmark Their RivalsMusk Unveils X’s AI Leap: Smarter Search, Deeper Integration of GrokiPhone Fold leaksdocuments obtained earlierreportsInternet ConnectivityTigrisawsApple’s iPhone 17 ProApple vs SamsungGalaxy S26 seriesBTCCrypto AnalysisPakistani Crypto Users Can Now Officially Report Scams, Issues via Grievance CellBitcoin on a Knife’s Edge: $107,000 Could Trigger a $259 Million Crypto MeltdownFrom Crises to Crypto: How Ripple USD (RLUSD) Is Speeding Up Emergency FundsBitcoin Slips to US $109K as Fed Caution Dampens Crypto RallyBISPNational AssemblyMVNOIslamabad High Court Dismisses Telecom Firms’ Appeals Against CCPBalochistan Suspends Mobile Data in Quetta for 24 HoursThe PTA Q3 2025 Cellular Mobile Operators (CMOs) Rankings Are HerePTA Q3 2025 Survey Report Exposes Shortfalls: Most Operators Fail to Meet Benchmarks Despite Zong, Jazz LeadHP5 uses advanced imaging technologiesKSE-100Stock MarketU.S. ElectionsMobile Networkauto industrycar salesPak SuzukiBIEKFBISEIBCCAmazon KuiperDigital PakistanSatellite Internetwww.pta.gov.pkFederal CabinetFirst Women Bank LimitedPrivatizationBitmojiElantra 2.0HyundaiHyperOS 3.0Android 16-based One UI 8 updateGalaxy Z Fold4Galaxy Z Flip4Sourcesandroid updatesBiologyEvolutionResearchLDI CompaniesWateen Telecom5G SpectrumSafe City ProjectSindh PoliceTimes Higher Education (THE)Times Higher EducationWorld University RankingsAI SubscriptionChatGPT GoOpenAI Expansionwinners of P@SHA ICT Awards 2018KeepTruckinWuklaFly MailKeepTruckInP@SHA ICT AwardsPriceOyeNETSOL Technologies Secures PKR 500 Million World Bank-Funded Contract with Khyber Pakhtunkhwa Government“Trade Lab”: A New Learning Avenue for Pakistani Startups & StudentsGold and Silver Prices in Pakistan Today, 10th November, 2025Nubia Z80 Ultra Hits Global Markets for Sale After China Launch27th Constitutional Amendment Targets Dual Citizenship in BureaucracyPunjab Sets New Emission Testing Charges for CarsCDA Sets Deadline for Completion of Islamabad Mega ProjectsMetro Bus and Orange Line Travel To Cost More in PunjabLandfall Spyware Targets Samsung Galaxy Devices Across Android 13–15OpenAI Sued Over ChatGPT’s Alleged Role in Suicides and DistressFIA Probes NCCIA Bribery Scandal Involving Scam Call Centres in IslamabadMeta Plans $600 Billion Investment in AI Data Centers Across the U.SNew PPSC Merit Policy IntroducedOxygenOS 16 Stable Update Rolls Out for OnePlus 12 UsersCDA Accelerates Work on Mega Projects Ahead of SCO Summit in IslamabadBill Gates Turns to Bollywood While Microsoft Bows Out of Pakistan: The Curious Case of Tech DiplomacyPunjab Orders Special Audit of All Driving License Centers After Corruption ScandalStudy Says Listeners Cannot Tell AI-Made Music Apart from Human-Composed TracksRupee Extends Winning Streak to 35 Days Against US DollarCrescent Fibres Temporarily Halts Operations at Nooriabad UnitFFC Wins the Prestigious ‘Company of the Year Award’SECP Registers 14,802 New Companies, Reflecting Strong Investor ConfidenceGermany Launches “Otus” Supercomputer: A Green Powerhouse for ResearchRoshan Digital Account Inflows Rise to $205 Million in October 2025Pharma Sector in Pakistan Reports 30% Profit Surge in 1st Quarter FY26Punjab Imposes Heavy Fines for 8 Major Traffic ViolationsGoogle Rolls Out Private AI Compute to Protect User DataPunjab Revises Syllabus for Grades 1 to 3 to Ease LearningTreet Corporation Approves Rs. 430 Million Production Expansionpic.twitter.com/96obquxaNbOctober 11, 2025Pakistan YouthYouth EmpowermentVR Headsets Might Actually Reduce Dry Eye Risk, Study FindsGoogle Rolls Out GKE Agent Sandbox and Inference Gateway to Super-Charge AI on KubernetesMassive Data Leak at Chinese Infosec Firm Exposes Alleged State Level Tools and Target ListsKarachi to Deploy Robots for E-Challans Under E-Tracks SystemKP Launches Insaf Female Education Card to Empower Women and Orphan StudentsKP Introduces Artificial Intelligence Education in All Public SchoolsPunjab Govt, British Council Join Hands to Improve Spoken English in SchoolsSuzuki EverySuzuki Every VXPunjab to Buy 25 New VIP Security Vehicles Worth Over Rs270mnDawn News Faces Backlash After Publishing AI-Generated Content in PrintHyperliquid and Avalanche Lead the Altcoin Revival as Market Momentum BuildsBitcoin, Ether ETFs Face $1.7B Outflow as Whale Accumulation Eases Market PressureBitcoin Back Above US $106K as US Government Shutdown Nears ResolutionEthereum Faces Tough Road to $3,900 as Demand and Market Confidence DeclineGoogle Introduces New Battery Usage Metric for Android AppsFAb Partners with a German Company to Deploy Automated Spectrum Management System in PakistanPTA Conducts Successful Raids in Lahore and Mansehra Against Illegal SIM Activities and Grey Traffic OperationsCapital Smart MotorsZeekr 009No E-Tag, No Entry: Islamabad Enforces Strict Vehicle Access RuleGold and Silver Prices in Pakistan Today, 13th November, 2025Punjab Launches Online Auction for Fancy Vehicle Number PlatesIndia In Talks to Acquire and Locally Produce Israeli Air LORA MissileALiExpressPakistan TaxesTechnology ParkNED UniversitySindh Governmenti2i Scale acceleratorFY25i2i Acceleratorlatest reportsApple May Change the Rear Design of the iPhone 18 ProApple to Bring AI-Powered Web Search and Health Agent with iOS 27iQOO 15 to Receive 5-Year of OS Updates and 7-Year Security SupportEuropean Commission Moves Toward Banning Chinese 5G Vendorsverified by SamMobileFederal Govt to Decide on Pakistan’s First 5G Auction This WeekAll Meta Platforms Disrupted Across Pakistan, Says Leading Internet ProviderMeta to Retire Facebook Like and Comment Buttons on External WebsitesGoogle Rolls Out Gemini AI on Google TV Streamer, Replacing AssistantReddit Expands Automated Ad Targeting With Custom Audiences & Streamlined UIpublic bus servicHonda ICON-eelectric scootersSindh EducationTeacher PromotionsNational AI Policy 2025Ignite PakistanNational AI FundNational AI PolicyGoogle Photos Adds Nano Banana AI for Smarter Photo EditingGoogle May Be Working on Nano Banana 2, And It’s Better Than The First!Internet banCDA to Redevelop Vacant Land in Islamabad’s F-6 and F-7 SectorsMobile NADRA Vans to Facilitate Registration in These Multiple Lahore Localities This WeekValve Opens Steam to Android Apps with New Steam Frame HeadsetMobilink Bank Wins 3rd Consecutive ‘Best Digital Banking Services’ Award (Microfinance) at CFA Society Pakistan’s Annual Excellence AwardsGoogle Launches AI Industry Fellowship to Accelerate Enterprise Innovation in PakistanGovernment Approves Rs. 330.43 Billion for PSDP 2025-26 Development ProjectsSchools in Quetta Closed Until Tomorrow Amid Security ConcernsPTA Issues Official List of Licensed VPN Providers for PakistanGillette Pakistan Applies for Voluntary Delisting from PSX Amid Global RestructuringGoogle Warns Billions of Android Users Over Fake VPN AppsIMF to Release $1.2 Billion for Pakistan in December After Board ApprovalDigital FraudPakistan’s Computer Emergency Response Team Advises Against Microsoft Windows Server VulnerabilityFoodpanda Pakistan Data Leak EXPOSED: Restaurant Owner Details Found Wide Open OnlineSindh TransportPakistan and France Sign Deal to Boost Minerals and Mining CooperationCall of Duty: Black Ops 7 Launch Patch Brings Aim Assist ChangesPunjab Mass Transit Authority Confirms T-Cash Card Price Remains Rs. 1302,152Smartphone Prices Too High? Government May Ease PTA Taxes SoonAlibaba-Backed Moonshot Unveils “Kimi K2 Thinking” AI Model, Claims to Rival Top U.S. SystemsJazz Tops PTA’s Telecom Complaints Chart for September 2025Samsung Galaxy A17 ReviewPakistan Launches Major Upgrade of National Internet Firewall to Boost Cyber-Security and Network ResilienceNCCIA Arrested Man for Selling Data of Millions of Pakistanis OnlineWateen Telecom Secures 20-Year Renewal of Its Long Distance International (LDI) License from PTASamsung Galaxy A07 ReviewFortnite x Stranger Things in Blitz Royale: Collab Teaser RevealedAramco & GO Pakistan Celebrate 50th Retail Fuel Station MilestoneiPhone 18 Pro to Feature Smaller Screen Hole Punch and Transparent Rear DesignPakistan’s $5 Billion Freelancing Dream on Hold: National Policy Stalled for Two Years Despite Booming Digital EconomyRegistrar Admits Error in HASCOL–Mena Energy $9.5m CaseSilent Hill 2 Remake Xbox Release Date Leaked by Microsoft StoreWhich Car Manufacturer Has the “Most Durable EV Battery”? Rigorous Testing Proves A WinnerHonda is Testing a New Hybrid System for its Upcoming Civic HybridOpenAI Set to Launch GPT-5.1, GPT-5.1 Reasoning, and GPT-5.1 ProToyota Hilux Enters the Electric Era with First-Ever EV Model Arriving in December 2025Realme C85 Pro ReviewWhy is Google Just Giving Away Its AI Pro Plan of 2TB Storage For Free?Dawn Urdu Website Reportedly Shut Down; Staff Members Laid OffAsia, Middle East Take the Lead in Internet Speed Rankings for 2024Sindh Govt Sets Strict Guidelines for MDCAT Retake on December 8, 2024Here’s How Freelancers Can Now Register VPNs via Mobile NumbersGovt Forms Committee to Revise Fiscal Measures on Bank Profits from Government SecuritiesMonument Valley is FREE for only one day on AndroidSECP to open help centers for new business owners across PakistanNow you don’t need a facebook account to use facebook messengerWin a free OPPO Neo 5s through #TechJuiceGiveawayGmail launches its ‘Undo Send’ feature – and here’s how you can enable it!PTCL introduces first 4G LTE tablet in PakistanGovernment lost Rs. 2 Billion over PTA’s concession for DV ComBeat the heat with these smart fabric tech clothes4 key lessons I learned while working with a social impact organization, IDEOSaad HamidPakistan Meteorological Department can not predict extreme weather conditionsOPPO Neo 5s Review: Amazing Features, Not So Big SizeBritish intelligence agency hacked Pakistan Internet ExchangePakistan may use latest technology to generate artificial rains2,0482,0492,0512,052Dubai Golden VisaKHDA PolicyPrivate Teachersreport by Topline SecuritiesPTCTelenor Pakistan’s Market Share Slips Ahead of PTCL Merger as Jazz, Zong StrengthenregistrationPehla Qadam BootcampregisterGemini 2.5Google AINotebookLLMOEC PakistanSkilled WorkersFaisalabad Development Authority Adopts Punjab’s e-Filing SystemEnergy SectorK-ElectricSaudi InvestmentDoja CatfortniteFortnitemaresElden Ring Nightreign Major DLC “The Forsaken Hollows” RevealedOverwatch 2 Mid-Season 19 Update Rolls Out Twitch Drops & Fresh ContentOverwatch 2 Reveals Stunning Cyberpunk Mythic Skin for JunkratDota 2 x Monster Hunter: Crossover Brings Free Cosmetic Sets#TechDestinationPakistanhttps://t.co/nvR46C4FdkOctober 6, 2025GO AI HubSaudi Vision 2030AI Reasoning Models Found More Vulnerable to Jailbreak Attacks, Study FindsPakistani Senators Report Falling Victim to Online Scams as Cybercrime Complaints SurgeKaspersky Launches a New Free Online Course on Cyberhygiene# Cyber AttackPTA Advances Data Localization: Unveils New Strict Cybersecurity Regulations For TelcosPKCERT Sounds High-Alert Over TP-Link Flaws Threatening Pakistan’s NetworksNational CERT portalAI CyberattacksSamsung’s New RAM Could Make the Galaxy S26 the Fastest Smartphone YetHuawei Might Be Making A Next-Gen AR/VR Vision With Ring-Wrapped TwistSamsung’s Galaxy Watch Will Now Tell You To “Eat a Salad”Apple Plans Affordable Mac to Take On Chromebooks and Windows# VR HeadsetsApple’s Live Translation Feature for AirPods Set to Launch in the EU Next MonthAMD Gears Up for Next-Gen RDNA 5 GPUs with Major Upgrades, But Fans Will Have to Wait Until 2026Air Link Prepares for First Acer Laptop Shipment as FY26 Plans AccelerateIs Apple Coming to Pakistan? Here’s What’s Going OnASUS Unveils TUF Gaming Radeon RX 9070 XT Call of Duty: Black Ops 7 Special EditionXbox UI showing a Steam integrationXboxXbox Series X|SPakistan’s IT Minister Outlines Bold Digital Future with Google’s Entry and Cloud ExpansionValve Officially Unveils Its New VR Headset After Years of RumoursBalochistan Suspends Mobile Data and Internet Across 36 Districts Amid Security AlertMaple Leaf Cement Eyes Strategic Acquisition of Pioneer Cement to Expand Market FootprintGoogle Play Just Found a Clever Trick to Save Your Phone’s BatteryGoogle Messages’ Upcoming Insights Feature Will Summarize Links Using Gemini AIGoogle Officially Registers in Pakistan: First Office Coming SoonGoogle Pushes AI Integration Further with Chrome’s New ShortcutGoogle Maps To Get Smarter: Say Hello to an AI Co-Pilot in Your CarYouTube Introduces Paid vs. Organic Metrics and AI-Driven Editing Tools for CreatorsGoogle Partners with Pakistan to Develop Regional Technology Hub, Says Finance MinisterIs Google Planning to Launch Space Orbiting AI Data-Centers? Here’s What We KnowGoogle Rolls Out Agentic Booking Capabilities in AI Mode As A Shift in How We Search92ZTE Blade V80 Vita Leaks Reveal iPhone-Inspired DesignApple Reportedly Pauses iPhone Air 2 LaunchApple Opens macOS Tahoe 26.2 Beta for Public TestingApple to Bring 24MP Selfie Cameras Across iPhone 18 SeriesiPhone Air 2 Rumored to Feature Dual-Camera Setup Next YearApple Starts Testing iOS 26.2 and iPadOS 26.2 with Developers105Microsoft Forms MAI Superintelligence Team to Build Human-Focused AI ModelsMicrosoft AI Plans ‘Humanist Superintelligence’ to Keep Humans in ControlOpenAI Restructures with Microsoft Backing, Moves Closer to IPOAuthors vs AI Giants: Judge Lets Copyright Suit Against OpenAI & Microsoft Move ForwardHalo 1 Remake Coming to PS5, Xbox, and PC: Without Multiplayer!Microsoft Expands Edge Game Assist With New Smart FeaturesMicrosoft Launches MAI-Image-1, Its First In-House AI Image Generator39Children Online SafetyDigital Services Act 2022AgriculturefarmersFABData LeakDiscord Breachlonger-duration immersive filmsApple Vision ProIslamabadSmart Water MetersScientists Miniaturize Quantum Optics into On-Chip Platforms, Marking a Major BreakthroughScientists Say Zinc-Based Batteries Promise Longer Life and More PowerScientists Achieve Breakthrough in Bioengineering Rare Octopus PigmentPunjab Launches Digital App to Empower Citizens With DisabilitiesResearchers Release First Draft Atlas of Developing Human BrainPakistan’s Fossil Fuels Demand Declines as Solar Energy Gains MomentumBeaver Supermoon to Light Up Night Sky Tonight, Says SUPARCO576TikTok Is Quietly Building Mixed Reality Goggles to Challenge MetaUS Govt Had Full Access To Twitter Private Messages:Elon MuskLawmakers in US State ‘Montana’ Vote to Ban TikTokZoom Acquires Employee Communication Platform ‘Workvivo’Indian Institute of Technology plans to seek talent from foreign countries, including PakistanHBL blocks thousands of Debit Cards in response to 2nd hackers attackThis trick to bypass an iPhone 6’s lock screen is fooling the mediaSaad MughalPakistanis get a free Gear VR for every pre-booking of Galaxy S7 seriesHTC sold 15,000 Virtual Reality headsets in under 10 minutesThis city has established “No-Selfie” zones in wake of selfie-related deathsSony to discontinue their Xperia Z smartphonesThrough this device, a smartphone can be fully charged in only 15 minutesLG unveils its sleek and beautiful 360 VR HeadsetLG announces G5 with always-on display, attachable “Friends” modulesIndian firm launched world’s cheapest smartphone and now it’s in troubleKPK Government launches an app competition with hefty prize moneyHackers take down hospital website, demand $3.6 Million in ransom560561563564Telenor acquires Tameer Microfinance Bank to scale financial servicesNetSol Technologies Signs Collaboration Agreement With Interactive 3D Mapping Company eeGeo9 new features in Android N that you didn’t know about8 things you should never say to a ProgrammerColliersAI JobsSilicon ValleyBusiness GrowthFAb with a German Company to Deploy Automated Spectrum Management System in PakistanOpenAI Eyes Health Tech with AI-Powered Personal Health AssistantPakistani AI Startup Jams Acquired by OpenAI in Landmark DealOpenAI’s TikTok-Style AI Video Maker “Sora” Gets An Android AppOpenAI’s Sora App Expands to Android Devices After iOS LaunchOpenAI Signs $38 Billion Deal with Amazon Web ServicesOpenAI Denies Viral Rumours: ChatGPT Did NOT Ban Anything!PayPal Partners With OpenAI to Enable Shopping in ChatGPTChatGPT to Handle Suicidals Safely: OpenAI Relaxes Restrictions22Facebook’s AI Can Now Create Collages from Your Phone PhotosPinterest Gives Users Power to Dial Down AI in Their FeedsMicrosoft Brings AI-Powered Photo Sorting to Windows 11Federal Schools to Introduce AI Learning for Students from Grade 8TikTok Is Quietly Testing an AI Feature That Lets You Shop What You WatchOpenAI Launches ChatGPT Atlas: The AI Browser That Reimagines Web SearchStudy Finds AI Chatbots Misrepresent News Nearly Half the TimeStudy Reveals AI Assistants Frequently Misrepresent News ContentOpenAI Unveils ChatGPT Atlas Browser in Direct Challenge to Google ChromeOpenAI Sets a Very Ambitious Target to Fund Massive Infrastucture23Meta Reveals Next-Gen AI Targeting System that Could Transform Digital AdvertisingMeta Made a Fortune From Scams, $16 Billion in a Single Year: Internal Documents ShowWhatsApp Announces Username Feature Ahead of 2026 Rollout for Businesses and UsersFacebook Now Lets Groups Flip from Private to Public: What Does It Mean?Threads Hits 150 Million Daily Users, Widens Ad InventoryPTA Partners with Meta to Roll Out Instagram Teen AccountsThreads Launches “Ghost Posts” to Foster Spontaneous SharingInstagram Introduces Custom Icons for Teens Amid Major Safety OverhaulMeta Unveils Senior-Focused Anti-Scam Features to Tackle Rising Fraud ThreatFacebook’s New Feature Lets AI Scan Your Camera Roll for Shareable ContentDeepSeek Launches New AI Model, Cuts API Costs by 50%China’s DeepSeek Unveils V3.2-Exp Model to Bridge Generational Leapimport of 500,000 of Nvidia’s advanced AI chipsUAEmonthly subscription plan just for IndiaclaudeAI AppGoogle OpalChat GPTLegal Battleshttps://www.techjuice.pk/wp-content/uploads/2025/10/AQMihkiSzpr-aDl0EWvMqmk_LRlxxZZb3CzeMkSN1iXHNjuBshji1jNJML8TPdCEDBAXCzXkKIUxzg0c5QXX7aOI.mp4V-JEPAAmazon Sues Perplexity AI Over Automated Shopping FeatureAmazon’s New Kindle Translate Lets Authors Expand Their Reach with AI TranslationsFirst-Ever AI-Powered Fire Suppression System Revolutionizes Naval Ship SafetyApple May Use Google’s Gemini AI to Power Siri in Upcoming UpdateAI Tool Detects Structural Heart Disease Using Smartwatch ECG in Ground-Breaking StudyOpenAI Faces Backlash Using Japanese Content Without ConsentGoogle Chrome Tests New “AI Chips” That Could Change How You BrowseHere’s How Pakistani Students Can Gain Free Access to Google Gemini ProElon Musk Unveils Grokipedia, AI-Powered Encyclopedia Aiming to Challenge WikipediaQualcomm Makes Major Push into AI Inference Data Centre MarketEA Pushes for Widespread AI Use: Developers Reportedly UnhappyChatGPT Integrates with Spotify, Canva & More: How to Use App ConnectionsReddit Expands AI Search to French, German, Spanish, Italian & PortuguesePakistan to Launch AI Sandboxes for Safe Testing, Tech GrowthGoogle Launches ‘Vids’, Now Everyone Can Create AI Videos For Free!White House Orders Tech CEO’s to Protect Public From AI RisksAI Can Soon Learn to Manipulate Humans: Warns Godfather of AIAmerican Technology Corporation IBM to Replace 7,800 Jobs With Artificial IntelligenceSuper Chat – An AI Chatbot that Will Allow You to Talk to Fictional CharactersCanadian Singer Grimes Says Anyone Can Use Her Voice For AI-Generated SongsNo More Fake Sick Leaves: This AI Can Detect Cold From a Person’s VoiceGoogle CEO Sundar Pichai Says AI Can be Harmful if Not Deployed CorrectlyElon Musk Forms New Artificial Intelligence Company Named ‘X.AI’Alibaba Announces Plans to Roll Out Generative AI Features Across AppsUS Lawmakers Begin Studying Possible Rules to Regulate AIAlibaba Invites Businesses to Trial its New AI ChatbotAI Can Now Crack Your Password in Less Than a Minute: Here is How You Can Stay SafeMark Zuckerberg and Other Meta Executives are Spending Most of Their Time on AI6061Google Photos Gets Generative AI: Allowing Users to Move Subjects Within an ImageApple co-founder Steve Wozniak says that AI Will Make Scams Harder to SpotGoogle Will Soon Add Smart AI Features to its SearchApple Will Use More AI in Future Products: Tim CookIT Ministry Debuts PM’s Cloud Enablement Program for StartupsLarge Language Marketers Launches Debut with “Generative AI for Creatives” Event at NIC IslamabadNIC Islamabad Celebrates Cohort 2 Graduation CeremonyUnity Retail – an e-commerce retail solution startup raises 6-figure USD seed investmentNIC is hosting a Virtual Open House for startups looking for mentorshipChkar.com – a vacation rental online marketplace raises Rs.50 million in funding from MFSYSFurniture Hub – A new style to buy Furniture!A conversation with the amazing Kalsoom Lakhani (on i2i Accelerator)Wordy! The upcoming anagram sensation by Data ArcMicrosoft’s Copilot teamleaks suggestApple EventiPadMacBooksOnePlus 15OnePlus PhonesXiaomi 17HyperOSpic.twitter.com/I3WorcyvTjMotorola Edge 70 seriesSamsung Galaxy S26 Ultra Set to Boost Wired and Wireless Charging SpeedsSamsung Galaxy S25 FE ReviewSamsung’s Galaxy S26 Series Could Follow Industry Trend of Higher Flagship PricesSamsung’s Tri-Fold Smartphone Hits Bluetooth Certification, Hinting at Global ReleaseSamsung Brings Its Internet Browser to Windows PCs with Beta LaunchSamsung Expands Galaxy AI to 22 Languages65Attock, Huawei to Build EV Charging Network in PakistanApple Shares Hit Record High as iPhone 17 Sales SurgeApple Urges Urgent Update as Image File Bug Hits iPhone, iPad, and Mac UsersApple Urges India to Revise Tax Law on iPhone EquipmentApple Has An Interesting Answer to the iPhone 17 “ScratchGate” SagaiPhonesaccording to the sourceiOS updatesPixel 10 seriesearly rumorsPixel 10 SeriesPixel 11 leaksRealme GT 7 Dream EdditionXiaomi Adds More Models to HyperOS 3 Testing Ahead of Wider RolloutHonor 500 Pro Details Leak, Showing Massive Battery and ChipsetRedmi Turbo 5 Pro Rumored to Deliver Massive Battery and Premium DesignOppo Confirms Reno15 Series Launch in China on November 10Moto G57 Series Debuts with Big Batteries, 120Hz Screens, and Android 16Motorola Launches Moto G (2026) and Moto G Play (2026)Vivo Y500 Pro Full Specifications Leak Ahead of Official DebutApple Releases iOS 26.1: New Toggles, Better Sound, and Smarter FeaturesOppo Reno15 Leak Reveals Key Specs and Performance Scores348Poco Pad M1 Surfaces on Geekbench AI, Revealing Key Specs and Chipset DetailsApple Intelligence in iOS 27 Could Be the Comeback Its Rivals Didn’t ExpectApple’s iPhone 18 Pro Leaks Reveal Bold New ColorsOppo Find N6 Leak Reveals Bigger Battery and Lighter DesignAyaneo Teases Its First Smartphone Built ‘Truly for Gamers’OnePlus 15T/15s tipped to feature flagship chipset and massive batteryUpcoming Vivo/iQOO Phone Packs Huge 8000mAh Batteryrealme 9 Pro+ now available across Pakistanrealme Leaps Ahead with the First-in-Segment Sony IMX766 OIS Sensor on realme 9 Pro+realme 9 Pro+ Takes Massive Tech Leaps in its Price SegmentTop 7 Android Apps for Astronomy EnthusiastsMicrosoft Innovation Center Holds Hackathon Windows 8.1QMobile Noir Z3 ReviewNooh KaziDownload the Top iPhone-like Parallax Wallpapers for AndroidThe Samsung Galaxy S lineup – Then and Now!The iOS 7.1 Update is Here15 Must have Google Chrome Extensions to Make Your Life and Browsing Experience—EasierNokia Lumia 1520 Unboxing and ReviewUsman YounasQMobile Noir Z4 vs. Samsung GALAXY S5: Battle of the FlagshipsWhy Facebook acquired WhatsApp?Wajiha LuqmanNokia Launches Analyser for Developers to Check Android Apps CompatibilityWhatsApp to Offer Voice Communication ServicesSamsung Galaxy S5: Meet The New Galaxy337338340341Investments in PakistanPak-Saudi RelationsThese 15 Major Sectors Lead Surge in Pakistan’s Sales Tax Revenue for FY 2024-25FBR’s Withholding Tax Collection Surges 32.7pc in FY2025-26FBR Reports Major Rise in Tax Collection from Sugar and Cement SectorsFBR Extends Deadline for Manual Tax Returns FilingFBR Uncovers Tax Evasion Among Pakistan’s Top InfluencersPunjab Revenue Authority Launches Special Unit for Tax ExpansionGovt Weighs Solar and Internet Taxes to Meet IMF Revenue ConditionsIMF Agrees to Revise Pakistan’s Tax Collection Target for FY2025Pakistan Business Council Urges FBR to Fix Tax Credit Error in IRIS System for Tax Year 2025Developer ToolsGemini CLIForeign investmentKSBFBR Launches AI-Powered Audit of 7 Million Tax ReturnsPakistan’s Tax-to-GDP Ratio Rises to 10.3% Amid Strong Direct Tax GrowthFBR Recovers Rs840 Million from Lahore-Based Leather Firm Over Tax EvasionFBR Extends Manual Tax Return Filing Deadline to November 30FBR Makes Digital System Integration Mandatory for High-Tax Distributors and RetailersFBR Rules Out New Taxes Despite Rs275bn Revenue ShortfallPetroleum Products Top Customs Duty Collection with Rs. 291 Billion in FY 2024-25FBR Expands Digital Net: 40,000 Retailers Now Linked to POS System NationwideSBP Governor Calls for Regional Integration to Strengthen Asian Capital MarketsSBP Orders Banks to Digitally Onboard SMEs via Video Calls and GPSGovt to Gradually Phase Out Remittance Incentive SchemesSBP Launches Online Portal for Investing in Government SecuritiesSBP Reserves Rise Again, Cross $14.5 Billion MarkSBP Plans Major Push for Financial Literacy in Pakistan by FY2028SBP Calls for Collaboration to Speed Up Islamic and Digital BankingPakistani Rupee Hits Six-Month High Against US DollarSBP to Block All Unverified Digital Wallets from Today, 25 OctoberPakistan Loses $9 Billion Annually to Financial Scams: Global ReportPSX Crosses 161,000 Points Amid Renewed Investor ConfidenceIMF Urges Pakistan to Include SPS Officials in Asset DeclarationsQatar’s Al-Thani Group Signals Exit From Port Qasim Power ProjectPakistan’s Trade Deficit Expands 56% Year-on-Year to $3.2 Billion in OctoberPakistan’s Wealthiest 10pc Hold 42pc of National IncomeWorld Bank Sees Pakistan Economy Growth at 3pc in FY26Crude Oil Prices Jump 4% After US Sanctions on RussiaFederal Tax Ombudsman Resolves 57,000 Tax Complaints in Four YearsGold Prices Drop Again in Pakistan as Global Rates FallCurrent Account Surplus Hits $110 Million in SeptemberPSX Rebounds After Three-Day Slide: Nearly 500 Points GainedUBL Faces Criticism Over Withholding Salary Funds on Credit DaysPakistan & Vietnam Boost Economic Ties: $3 Bn Trade Target SetSBP Injects Rs. 400Bn: Shariah-Compliant Mudarabah-Based OMOPakistan Stock Market Volatility Highlights Need for DepthSECP Partners with Digital Banks to Simplify Corporate Account Opening for StartupsSECP Holds High-Level Consultation on Reforming Pakistan’s Cost Audit RegimeSECP Approves Amendments to PSX Rulebook for Holding and Conduct of Corporate Briefing SessionsSamba Bank Gets SBP’s Green Light to Become a Full Islamic BankDaira Marks One Year of Empowering Pakistan’s Unbanked PopulationSECP Flags Legal Breaches in PRCL CEO Appointment and Pay RaiseSECP Partners with National Telecommunication Corporation to Enhance CybersecurityPakistan’s SLG-Trax in Talks to Acquire Singapore’s FinovaState-Owned Strategic Digital Wallet Company Set Up in PakistanSECP Proposes Legal Framework for Waqf CompaniesPakistan Pays $2.69 Billion in IMF Interest Since 2008, Including $533 Million in SurchargesIMF Seeks Special Audit of Pakistan’s Supplementary GrantsPakistan Unveils Landmark Industrial Policy to Drive Investment and Modernize IndustryIMF Offers Pakistan Technical Assistance for New NFC AwardFBR Tightens Sugar Mills Monitoring Ahead of Crushing SeasonIMF Projects Pakistan’s Economic Growth at 3.6pcIMF and Pakistan Seal $1.2 B Staff-Level Deal Under EFF and RSFPSX Plunges Over 1,700 Points Amid Heavy Selling PressureSupernet Profit Rises 27pc in 1QFY26PSX Gains 210 Points Amid IMF Deal, Profit-TakingBlue-Ex Limited Applies for Migration to PSX Main BoardPSX Hits Record 168,990 Points as Investors Cheer Economic MomentumPak Tech Companies Outperform PSX With 112% Returns in 5 YearsFauji Fertilizer to Acquire the Last 25% Stake in FPCL From Fauji FoundationPACE Pakistan is All Set to Enter Dubai Real Estate MarketPSX Introduces Guidelines for Minor Trading AccountsPSX Turns Green: KSE-100 Index Surges Over 3,200 PointsAtlas Honda Half-Year Profit Soars 45%: High Motorcycle DemandNBP Records PKR 23 Billion Profit in Q3 Calender Year 2025PSO Profit Soars 136% to Rs. 9.39 Billion in Q1 Fiscal Year 2026Indus Motor Reports Rs. 6.72bn Profit in Q1 Fiscal Year 2026Shifa International Hospitals to Merge SMCI into Parent CompanyComplex Tariff Reform Could Boost Pakistan’s Exports by 14%Pakistan’s Workers’ Remittances Reach $9.5 Billion in Q1 FY26Pakistan Falls Short on IMF Fiscal Conditions as Provinces Miss Targets2035 Forecast: Pakistan’s Economy to Hit $1 TrillionRs. 1.47 Trillion Surge in Banking Sector in October 2024Pakistani Startups Secure $32 Million in FY2024-25 Amid Rebounding Investment ClimatePakistan’s October 2024 Remittances Hit $3.05bn, Reflecting 24% Annual GrowthRoosevelt Hotel in New YorkPIAShehbaz SharifFewer Than 700,000 Retailers in Pakistan Use Digital PaymentsPakistan and Bangladesh Launch Direct Shipping Link to Boost Tradeaccording to dataFinance ministryFWBLUAE InvestmentBusiness ChambersCommerce MinistryTrade PolicySpecial Investment Facilitation Council (SIFC)National Savings Profit Rates RevisedOICCI Survey 2025: Foreign Investors Show Renewed Confidence in Pakistan’s EconomyLUNA Coffee Faces Court Case Over Alleged Misleading BrandingIndustry Rejects Govt’s New Power Package, Warns of Factory ShutdownsNational Assembly Passes Asaan Karobar Bill 2025 to Boost Business EasePakistan Records Rs. 2.1 Trillion Budget Surplus in Q1 FY26Industries Ministry Seeks End to Customs & Import TaxesGold and Silver Prices in Pakistan Today, 11th November, 2025Gold and Silver Prices in Pakistan Today, 7th November, 2025# Gold Price# Silver PricePakistan Targets $200 Million Meat Exports to Malaysia as Commerce Minister Chairs Key MeetingTorkham Border Closure Costs Pakistan Over $4.5 Billion in TradeGul Ahmed Warehouse Caught Fire: Insurance Coverage ConfirmedPakistan Nears $600M World Bank-Backed Public Finance Reform ProgramRupee Strengthens for 33rd Day as Market Shrugs Off Political NoisePakistani Rupee Expected to Weaken to 295 Against US Dollar by 2026KSE-100 Index Projected to Reach 203,000 by December 202698Gold and Silver Prices in Pakistan Today, 12th November, 2025Pakistan Invites Saudi Arabia to Invest in Major Motorway ProjectsGovernment Collects Rs. 371 Billion in Petrol Taxes in Q1Weekly Inflation Drops 0.59%, But Yearly Prices Still Up by 4.18%Gold and Silver Prices in Pakistan Today, 8th November, 2025Fuel Prices Set to Rise by Rs3/Litre as Sindh Reimposes Petroleum Import CessPakistan’s Real Effective Exchange Rate Rises to 101.73 in September 2025Pakistan Records $594 Million Current Account Deficit in 1QFY26Utility Stores Employees Forced to Work Without PaySBP Lowers Interest Rate to 11% on Inflation ReliefTemu Halts China-to-U.S. Shipments Amid Rising TariffsBuffett to Step Down as Berkshire CEO, Greg Abel Named SuccessorMeezan Bank Offers Shariah Financing for Peugeot 2008Italy Throws Support Behind Pakistan Textile SectorPakistan Foreign Reserves See Slight Weekly Increase to $10.214 BillionDubai Islamic Bank New CEO Muhammad Ali Gulfaraz Takes ChargeBank Alfalah sells entire Stake in Alfalah SecuritiesOctopus Digital Faces Sharp Profit Drop in Q1 2025FBR Seals Famous Clothing Brand in Karachi for Major Tax EvasionNo Major Sales Tax Relief Expected for Businesses in Budget 2025/26FBR Suggests Tax Relief for Salaried Class in Upcoming Budget7477JF-17 and J-10C Maker’s stocks surge, Rafale’s Dassault Aviation’s slumpIndia suffers $956 Million Loss as Pakistan Downs 5 hi tech Indian jetsPakistan stock exchange plunges: Market gripped by all out war fearsBank Al Habib to shut down Kenya office amid Global RestructuringGet Your Honda CG150 with 0% Markup Through Easy Installments# Atlas Honda# Electric bikes# e-bikes# electric scooters# CM Punjab# Honda CG125# YamahaGet Yamaha Bike Now, Pay Later with 0% Mark-Up from SCBHere’s How You Can Earn 100K from Punjab Govt by Going Electric with Your BikePunjab Govt Offers Rs1 Lac Reward for Converting Petrol Bikes into EVsSuzuki unveils new designs for GS150 and GD110s in PakistanEV Manufacturers Warn of Setback as Sales Tax Rises to 18%Xiaomi EV Launch in Pakistan Delayed Amid China DemandIslamabad Launches Clean Air Plan to Control Vehicle EmissionsBYD YANGWANG U9X Becomes World’s Fastest CarNew EV Charging Station Installed at Key Location in LahoreSindh to Monitor All Public Transport Under Safe City NetworkChinese Company Unveils New Pilotless Air TaxiPunjab Opens Applications for 12,500 Teacher Intern PositionsPunjab Imposes Strict Ban on Outdoor Activities in Private SchoolsPunjab Proposes Fare Hike for Lahore Metro Bus and Orange Line TrainPunjab Tightens Crackdown on Smog Violations With 51 New Cases FiledApni Chhat Apna Ghar Simplifies Home Registration for CitizensPunjab Announces Winter Vacation Schedule for SchoolsPunjab Launches Paid IT Internship Program for Young GraduatesPunjab Rejects Electric Bus Fare Hike to Support Affordable TravelKarachi Gets New Electric Bus Route Under Sindh Transport InitiativePunjab to Launch 28 Electric Buses in Gujrat by DecemberElectric Bus Service in Gujrat to Launch by December 2025Punjab Launches Major Electric Bus Rollout Across 24 DistrictsBelarus Proposes Joint Assembly of Electric Buses with PakistanSuzuki Teases a Mystery Car for PAPS 2025: Here’s All We KnowSuzuki Discontinues Every VX Variant in Pakistan Amid Market SpeculationSessions Court Advises Sindh to Set Up Special Court for Mines and MineralsSindh Lifts Ban on Government Jobs, Launches Digital Hiring SystemSindh Govt Launches Second Phase of Pink Scooty Scheme for WomenSindh Expands Women’s Electric Scooter Training to More Cities After Karachi SuccessSindh CM Orders Probe Into KDA Rs11.33bn Development ContractsSindh Approves Rs. 2.89 Billion for Development Projects in KarachiSindh Govt’s New Policy May Trigger Countrywide Fuel ShortageSindh Govt Makes Approval Mandatory for Fee Hike at Public UniversitiesJMEV ElightFiscal Year 2026Lahore metroOrange LineJAC T9Nissanpickup truckIndus Motor Company (IMC)ToyotaUsed Carse-bikesBattery SafetyPakistan Auto Sales Surge 32% in October 2025, Suzuki Alto Leads MarketRawalpindi Simplifies Driving Licence Process for MotorcyclistsKarachi Citizens Move Sindh High Court to End E-Challan SystemPunjab Launches E-Challan System in Faisalabad to Boost Traffic DisciplineE-Challan System Officially Launched in Gujranwala to Enhance Road SafetyPunjab to Enforce Mandatory Helmet Rule and Stricter Traffic Fines# Pakistan RailwaysMetro Bus Service to Pause in RawalpindiKarachi Bans Heavy Traffic on Jinnah Avenue for Smooth Flow68 Police Vehicles Fined Under Karachi’s E-Challan SystemIslamabad–Tehran–Istanbul Rail Service Set to Resume This YearChery to Launch 3 New SUVs: Pakistan’s Auto Market Expands But Affordability Concerns Still LoomFaisalabad and Gujranwala Railway Stations Receive Major UpgradesPunjab Launches Dubai-Like Traffic Monitoring and Points System50Imported Used Cars Cost Pakistan’s Auto-Parts Industry Up to Rs60 Billion AnnuallyIslamabad Launches First-Ever Car-Free Pedestrian Zone in Blue AreaSHC Notices Petition Against Karachi E-Challan SystemPassenger Bus Services Suspended for Three Days Amid Security ConcernsNexperia Takeover: China Blames Netherlands for Chip CrisisVolkswagen to Build Its Own Assisted Driving Chip in ChinaLahore Traffic Police Crack Down on Unfit Vehicles to Curb SmogNew Traffic Fines and Rules Announced for Motorcyclists in RawalpindiPunjab Launches E-Challan System in Rawalpindi to Boost Traffic SafetyPakistan’s Oil Marketing Companies Post 9% MoM Rise in October SalesmusicOppo Reno13 FOppo Reno13Oppo Reno13 ProHonor Play 10Oppo A5iOppo Reno 13 FSindh Enforces Strict Road Safety Measures for Student TransportationPBC Recommends 10-Car Ownership Cap to Tackle Tax Evasion in PakistanJetour to Introduce T1 and T2 SUVs in Pakistan This YearJetour Dashing Officially Launched in Pakistan; Price, Specifications, and Booking DetailsCM Maryam Nawaz Launches Punjab’s First Eco-Friendly Electric Bus ServiceMG Motors Pakistan Announces Limited-Time Price Cut for HS PHEVPakistan’s First Self-Driving Car Set to Launch in Six Months by NED University StudentsGovt Requests NEPRA to Lower EV Charging Prices by 45%, Aiming for 30% EV Adoption by 2030Dewan Motors Plans Electric Pickup Launch in Pakistan4044Punjab Introduces New Vehicle Registration RulesGovt Pledges Support to Japanese Automakers, Links Incentives to ExportsBattle of SUVs: H6 vs. Dashing vs. HS vs. X7Punjab’s First Underground Metro Train Coming to LahoreK-Visa Launched by China to Attract Foreign Tech TalentMohammad Jawed Akhai Foundation Establishes Early Learning Centre at Baba IslandHEC Delays Aptitude Test for Balochistan and Erstwhile FATA ScholarshipsHEC Updates Curriculum for Business and Management Degree ProgramsKarachi University Admission Test Passing Rate Falls to 39%HEC Approves New Curriculum for Business and Management StudiesHEC Adopts Skill-Based Curriculum to Tackle Declining University AdmissionsHEC, Academia & Industry Join Hands to Revise Computer Science CurriculumHEC Announces New Dates for ETC TestsHEC Announced Internships and Certifications Mandatory for Undergraduate ProgramsHEC Makes Internships & Certifications Mandatory for DegreesHow to Check Your Status in the PM Laptop Scheme 2025 OnlinePakistani Universities Secure Spots in QS World University Rankings for AsiaPublic SchoolsSchool FundingPhD ScholarshipsPunjab ScholarshipsMatric examRain DisruptionBISE Lahore Implements New Fee Payment System, Causing Student InconvenienceLahore University Announces Full Fee Waiver for Disabled StudentsQAU Partners With Cambridge University to Boost Research InnovationRawalpindi Schools to Open at 7:45 AM Amid Katchery Chowk ConstructionRecruitmentPunjab Reissues Corrected 9th Grade Smart SyllabusSindh to Introduce Cambridge IGCSE in Public SchoolsPunjab Govt Approves Recruitment of School Teacher InternsBeaconhouse Golden Jubilee Highlights Vision to Redefine Pakistan’s Education SystemPM&DC Restores Passing Marks to 50 Percent for MBBS and BDS StudentsRussia Announces Fully Funded Scholarships for Pakistani StudentsPunjab Begins Privatizing Public Colleges After Schools, Faces Strong BacklashAll You Need to Know About the Specs of Prime Minister’s Youth Program’s 2025 LaptopPunjab Opens 12,500 Internship Opportunities Under New STI ProgramPM&DC Rejects FIA’s Claims After Staffer Arrested in Admission ScamHEC Opens Applications for Access to Scientific Instrumentation Program 2025-26Ignite Reopens DigiSkills 3.0 With 300,000 Free Seats for PakistanisHow to Download CSS MPT Roll No Slip 2026 from FPSCPunjab Overhauls Exam System, Replaces Practical Tests With MCQsPunjab Moves to Improve Education Board Efficiency With New 2025 OrdinancePunjab Announces Saturday Holiday for Special Education SchoolsInternational Students Face Tougher Entry as Canada Tightens PermitsPunjab Lets Parents Check Students’ Exam ResultsBISE Multan Announces 11th Class Results 2025All BISE Punjab Boards HSSC Part II Result 2025 Date AnnouncedKarachi Students Summoned in BIEK Result Scam ProbeMuzaffarabad Cracks Down on Private Schools’ Direct Fee DemandsOver 41,000 take engineering colleges admission testMuneeb AhmadUS plans to establish IT Park in Hyderabad20 Mehran UET students are headed to USA to work on water sustainabilityUET Lahore names new hostel after Abdul Sattar EdhiHabib University sends 15 Pakistani students for Enterprise Summer Program in SingaporeMicrosoft’s new online degree program will prepare you for high-tech employmentUSAID grants $20million to UET Peshawar for research in the energy sectorTop 5 things youth look for in a job and why businesses should consider them importantChanneling Energies – Raising Problem SolversNabeel A. QadeerPakistani kid develops a full-fledged defense drone and he’s only 11!NUST students are representing Pakistan at RoboCup 20168 students of Habib University to represent Pakistan at Stanford Summer International Honors ProgramBalochistan unveils Rs. 289 billion budget with added focus on education82838586Ahsan Iqbal to promote STEM education in PakistanYayvo.com Launches Get Set School, First Education Store Catering To Student NeedsThe Grid: Pakistan’s first Virtual Reality Lab at NED UniversityNone in top 500, only two Pakistani universities made it to the world’s top 800Available
OPPO A6 ProRs. 74999Available
Samsung Galaxy S25 FERs. 254999Featured
Infinix Hot 60 ProRs. 45999Upcoming
Infinix Hot 60 Pro+Rs. 59999Available
Realme GT 7 Dream EdditionRs. 219999Available
Apple iPhone 17 Pro MaxRs. 473000Available
Apple iPhone 17 ProRs. 520500Available
Apple iPhone 17 AirRs. 480000Available
Apple iPhone 17Rs. 399000Realme C85Realme C85 ProZTE nubia Z80 UltraMotorola Moto G Play (2026)Motorola Moto G (2026)Oppo A18PM Youth LaptopSamsung Galaxy A17Samsung Galaxy A07 4GMeizu Note 22 ProMeizu Note 22Meizu Mblu 22Meizu Note 22 4GMeizu Note 16Meizu Note 16 ProAPGJSAGoldChromeTecno Camon 40 PremierHonor Magic8 ProHonor Magic8Honor X6cHonor 400 ProHonor 400Honor X70iVivo iQOO 15Vivo V60 Lite 5GVivo V60 Lite 4GMECHREVOHyundai ElantraHyundai PakistanSedan UpdateAir Link Acer Laptops’ Launch Delayed Amid Shift to CBU ImportsPakistan Digital Transformation Poised to Deliver $20bn in Economic ImpactApple TV Gets a New Intro and Soundmark as Apple One Debuts a Colorful New LogoGoogle Chrome Can Now Auto-Fill Your Passport and Driver’s License DetailsCanva Launches Its Own Design Model with Major AI UpgradesApple Finally Rolls Out Full-Featured Web Version of Its App StoreScientists Make Laser Neural Implants That Monitor Brain Activity WirelesslySamsung Galaxy S25Samsung Galaxy S25 UltraSamsung Galaxy S24 FESamsung Galaxy A56 5GSamsung Galaxy A55Samsung Galaxy A26 5GXiaomi 17 Pro MaxXiaomi 17 ProXiaomi 15T ProXiaomi 15T26IT CollegesSamsung Galaxy F05Rs. 21,999Available
Realme Narzo N63Rs. 28,500Meizu mblu 21Rs. 26,999Realme Narzo 80xRs. 42,999ZTE nubia Neo 3 GTRs. 116,999Motorola Moto G86Rs. 96,999Available
Oppo F29 ProRs. 91,999Rumoured
Tecno Pova 6 ProRs. 68,999Realme Narzo 80 ProRs. 65,999Available
Samsung Galaxy A17Rs. 54,999Available
Samsung Galaxy A07 4GRs. 27,500Available
Samsung Galaxy S25 FERs. 254,999Available
Oppo Reno13 FRs. 79,999Available
Oppo Reno13Rs. 149,999Available
Oppo Reno13 ProRs. 219,999Available
Honor Play 10Rs. 19,999Available
Oppo A5iRs. 27,999Upcoming
Infinix Hot 60iRs. 32,999Upcoming
Infinix Hot 60 Pro+Rs. 59,999Featured
Infinix Hot 60 ProRs. 45,999Available
Tecno Camon 40 PremierRs. 129,999Available
Tecno Spark Go 2Rs. 23,999Available
Tecno Spark 40 ProRs. 48,999Vivo Y29Vivo Y19sVivo Y04Vivo X200 Pro20Realme Note 70Realme Note 50Realme 15TPakistanis Reportedly Hold Around $30 Billion in Crypto AssetsGmail Users Alert: 183 Million Passwords Leaked in Security BreachPakistan Stock Exchange (PSX)Pakistani BanksFerrari ElettricaInfinix Smart 10 PlusInfinix Hot 50 Pro PlusInfinix Note 50 Pro 4GInfinix Note 50Infinix Zero 40 4GCurriculum ReviewMatric StudentsHonor GT ProCADAEDCADAUDCADCHFCADCNYCADEURCADGBPCADINRCADJPYCADMYRCADSARCADSGDCADTHBCADTRYDOGESolanaXRPBitcoin DropBTC-PKR$215 million in Bitcoin$BTChttps://t.co/jYUCx8A3sRpic.twitter.com/7dpZr8AjTwOctober 7, 2025ETHBitcoin Dips Below $100,000 Before Stabilizing, but Markets ShudderCrypto Market Mood Plummets to “Extreme Fear” as Bitcoin Slides Below $106KSindh Govt Denies Viral ‘High-Level Security Alert’ in KarachiBitcoin Risks 20–30% Drop as $1.1B Gets Liquidated in 24 HoursBitcoin Slips to $113K as S&P 500 Hits New Record Ahead of Fed DecisionBitcoin Surges to $116,000 as Traders Eye CME Gap and Fed Rate DecisionStrategy Logs Slowest Monthly Bitcoin Buys of 2025, Adding Only 778 BTC in OctoberBitcoin Closes $107K CME Gap as Markets Eye Friday’s CPI DataBitcoin Hits $110K as Gold Plunges 5%, Markets Show Sharp DivergenceBitcoin may retest $102K as gold hits record highsUS Spot Bitcoin, Ether ETFs See $755M Outflow After Market CrashDubai Makes History with First Tokenized Property Investment ProjectSIFC Brings Pakistan’s First Blockchain Based Data centerPakistan Crypto Council, US Envoy talk Blockchain, AI & youth empowermentHow to Earn From Paws Telegram Mini App (latest guide)U.S. Proposes Clean Cloud Act to Rein In Crypto and AI’s Growing Power DemandPakistan Plans to Utilize Surplus Electricity for Bitcoin Mining and AI Data CentresBinance Founder CZ Meets Nawaz Sharif, Maryam After Being Appointed as Adviser to PCCPM Pushes for Crypto Growth: Pakistan Eyes $3.5 Billion Bitcoin Mining PlanSindh Govt Launches Blockchain-Based Digital Land Record SystemPakistan Eyes Blockchain to Enhance Remittance Efficiency and Reduce Costs, Says Crypto Adviser Bilal Bin SaqibPi Network Gears Up for Open Mainnet LaunchEthereum’s Drop to $3,000 Sets Stage for $7 Billion Short Squeeze Amid Market VolatilityBitcoin Crashes to $99,000 as Crypto Market Wipes Out $1 Trillion in a MonthEthereum Makes a Power Play for Wall Street: New “Institutions” Website Targets Big FinanceEthereum Spikes Briefly Above $4,000 as Whale Moves $82 MillionEthereum Faces 60% Drop Warning as Bearish Signal FlashesWas the October 11 Crypto Market Crash an Organized Attack? Here’s What We KnowOctober Pivotal for Crypto: U.S. SEC to Rule on 16 ETF ApplicationsEthereum Could Smash $5,000 by 2026, Say Crypto TradersFIA Probes Binance Transaction in Rs90 Million NCCIA Bribery CaseBinance Expands Hiring in Pakistan as Crypto Hub Momentum BuildsBinance Opens Bitcoin Options Writing to All UsersBinance Wants You to Pass on Your Crypto—Even After Death!Binance Founder Changpeng Zhao Joins Pakistan Crypto Council as Strategic AdvisorMGX’s $2 Billion Investment in Binance Reshapes Crypto LandscapeBitcoin Surges Higher, Hits $86,602 MilestoneBybit Suffers Historic $1.5 Billion Crypto Heist in Largest Exchange HackTop Cryptocurrency Platforms & Apps in Pakistan for February 2025FTX Sues Binance and Former CEO Zhao for $1.8 Billion in Fraudulent Transaction ClaimsBinance Founder Changpeng Zhao Released from US Custody After Resolving Anti-Money Laundering CaseMastercard and Binance to End Crypto Card Partnership7 of the very best one reasons in our guide yesterdayHostGatorlink‘TECHJUICE25‘BluehostthemesbloggingearnwordpressOnline Earning8 Million Pakistani Women Working Online, Claims IT MinisterProductivityRoblox Now Allows You To Buy Physical MerchandiseYou Can Easily Recover Your Hacked YouTube Channel Now: Here’s How?Pakistan Rio 2016rolled outupdatedbiggest update everstoriesupdateadopted by the Senate last weekscheduled to become a law this weekDawnCyber CrimeFIAlawexpired this weekMicrosoft’s Windows AccessibilityMicrosoft’s Windows 10 Anniversary updateInternationalupgradeWindows 10Which Seat Of The Plane Is The Safest According To Experts?6 Ways To Personalize Your Google Chrome On Windows#GoGreenCampaignpic.twitter.com/G9v2ihbyd3August 1, 2016Arjumand A. Hussain#Karachipic.twitter.com/aa3PL1K3Dt#IBleedGreenpic.twitter.com/5IYlQg5Avkpic.twitter.com/YXjlAulaokpic.twitter.com/vOBRi8ZaHKrecent release on Androidnews reportgorgeous picturespersonPrismaslider#DNCinPHLhttps://t.co/jTGPxm3GCVJuly 29, 2016SomeWired journalistPakistaniFixr.comSearchPokemon GoTribuneFacebook page to join in on the funmaps for finding PokemonsUber-style rideshow you can play itGamePokemonCareemraising investment at a 4 million dollar valuation last yearinternational with service launch in Myanmar as wellallow its customers to let their friends track them in real-timepartnershipTelenor Velocity extends deadline for second batch to 30th of AugustShutterstock comes to PakistanBroadband penetration to cross 38 percent by 2020, says Anusha RahmanTelenor awarded technology neutral 850MHz spectrum for 4G licenseGoogle’s Phone app will now warn you about a spam callerThis is how you can remove the Prisma watermark from your photosGoogle Maps updated with cleaner design and areas of interestHere’s why some Japanese say pets can see Pokemons in Pokemon GoThis social media campaign against Facebook censorship and two faced policies is going viral!Facebook and Instagram remove accounts of social media celebrity, Qandeel BalochThe fastest man on earth now has his own emoji keyboard, called “Boltmoji”China’s apparel price surge could create 220,000 new jobs in Pakistan, says World BankA complete guide to playing Pokemon Go in PakistanThis map lets you find every Pokemon near you in PakistanGovernment launches Science Talent Farming Scheme with 1.5 billion rupees in fundingWant to see Pakistan as a strong technology based country, says Federal minister for Science and TechnologyNetSol awarded best Finance and Leasing solution provider at the China Leasing Summit, 2016Indian court serves notice to Google for listing PM Modi among Top 10 CriminalsEveryone’s favorite filter app, Prisma, has finally come to AndroidUnfavorable operating conditions may force Telenor to leave IndiaChinese are angry with America, so they are smashing their iPhonesFacebook bans Hamza Ali Abbasi, removes his post supporting Kashmir leaderHackers are going to take down Pokemon Go on 1st of August just for the fun of itHere is how you can change your Facebook Page’s nameHere’s how you can connect a USB to your Android deviceHere’s all the data Pokemon Go is collecting from your phone without you realizing!Samsung breaks the record for largest ever hard-driveHarvard Student Creates App Using Messenger Privacy Flaw; Facebook Cancels InternshipSamsung Unpacked 2015: Galaxy Note 5, S6 Edge Plus, Gear S2 Smartwatch announcedSamsung Note 5 Event: When & Where to Watch?Sundar Pichai as CEO: Wikipedia goes to war over where he studied!Sumail Hassan, 16-year-old Pakistani kid, scoops Guinness World RecordNADRA recognizes Kalash community, adds separate column in CNICSamsung Galaxy Unpacked 2015: What To ExpectTop 10 tech myths Pakistanis follow religiously10 Epic Themes For Your Next Wordpress Blog, 2015Massive reorganization at Google results in new CEO and another companyIndian Government on high-alert against possible Pakistani hacking attempt27Pakistan Atomic Energy Commission to generate a massive 8,800 MW in the next decadeApple Siri will now answer calls for youNADRA poised to setup DNA Lab in 6 monthsFederal Government quietly imposes another tax on Internet connections all over PakistanApple lost top rank in smartphones against Chinese brandsInternet.org plane to bring 10Gb/s internet speed to regions out of internet reachRovio launches the Angry Birds 2.0Why you should not upgrade to Windows 1019.5% Tax on Mobile and Household internet packages reversed in PunjabForget Selfie Sticks, Samsung brings you a Selfie DroneGoogle Now integrates popular messaging apps to its voice assistantMicrosoft Innovation Center offers Internships to 7th Batch of IT GraduatesMajor security threat affects 95% of Android usersSteampic.twitter.com/205lXNVtAnBattlefield 6EA GamesiPhone 17 Lineup Now Eligible for Apple’s Self Service Repair ProgramAdobe Temporarily Disables Selfie Camera in Project Indigo for iPhone 17 UsersiPhone 17 Pro Durability Tests Reveal Scratch Issues on Blue and Orange ModelsPTCL Launches iPhone 17 with Official Distributor Including Exclusive OffersiPhone 17 Series Battery Leak Ahead of LaunchiPhone 17 Series Pro Model to See $100 Price HikeApple Releases iOS 26 Beta 9 and macOS Tahoe Ahead of iPhone 17 LaunchiPhone 17 Lineup Expected to Feature Dynamic Island DesignApple iPhone 17 Pro’s Leaked Design Changes Everything You Thought You KnewiPhone 17 Air’s Sleek Design and Camera Bump Details LeakedApple iPhone 17 Models to Retain Dynamic Island Size from iPhone 16 LineupApple’s iPhone 17 to Feature Smoother Camera Bump DesignVanilla iPhone 17 Expected to Get High Refresh Rate Screen UpgradeSereneAir’sChallenges#CB2025pic.twitter.com/E2ll6KKfrCMay 25, 2025Bandai NamcoTekken 8Overwatch 2 Season 20: New Season Content TeasedCall of Duty: Black Ops 7 File Size Exceeds 130GB on PS5 and PCTake-Two Stock Plummets Nearly 10% After GTA VI DelayGTA VI Delayed Once Again: Rockstar Confirms New Launch DateGTA 6 PlayStation Store Update Sparks Speculations About a Potential 3rd TrailerPeak-Hour Congestion, High Latency & Jitter Still Undermining Pakistan BroadbandPTCL & Zong Among Pakistan’s Worst Broadband Performers: PTA Q3 2025 ReportGold and Silver Prices in Pakistan Today, 5th November, 2025First Chromebook Assembly Line Inaugurated: Google deepens local presence in PakistanOverseas Ministry Stops FIA’s Controversial Travel Guarantee RuleArc Raiders Players Defying Norms by Choosing Peace Over WarGTA 6 Facing Another Delay? Conflicting Reports from DevelopersFortnite x The Simpsons: Simpsons Just Offed The Popular ‘Peely’Phantom Ultimate G Fold: TECNO’s Revolutionary Tri-Fold Phone ConceptVivo X Fold 5: Top Features & Full SpecsWhy Is Samsung Delaying Launching Their Tri‑Fold Phone?Tecno Phantom Ultimate G Fold Concept Coming SoonGoogle Announces Pixel Fold: But Its Price Will Make Your Heart Skip a BeatRollable Screens could be the next Tech Breakthrough for SmartphonesVivo Set To Launch A Foldable Phone This YearHonor 500 and 500 Pro Teasers Confirm Key Design DetailsVivo Launches Official E-Store in Pakistan with Exclusive Offers and RewardsCCP Recovers Rs 772 Million from ICH Cartel CaseYouTube TV Compensates Users with $20 Credit Over Disney Channel ShutdownRealme C85 Pro Officially Launched in Pakistan, Featuring 7000mAh Battery and IP69 Pro ToughnessDenmark Moves to Ban Social Media for Children Under 15Amazon Launches Bazaar, a Low-Cost Shopping App Across Multiple CountriesMicrosoft Expands Xbox Age Verification Beyond the UKOppo Reno 14 Series launch Date ConfirmedVivo iQOO Z10 Turbo+ Set to Launch Next Week with Massive BatteryApple Hits Major Milestone: 3 Billion iPhones Shipped WorldwideXiaomi Redmi 15 Series, Including 5G and 15C, Officially Debuts in PolandTrump’s Oil Deal Clears Path for Pak-US Crypto CollaborationGoogle Pixel 10 Series Prices Leak for US and CanadaPTA Finds Major Telecom Operators Failing QoS Standards in 2025 SurveyWill Prices of Aliexpress & Temu Drop after FBR Latest Tax Exemption?Ministry of Commerce Accused of Rs9.47B Financial IrregularitiesPakistan Faces Nationwide Internet Disruptions: Here’s WhyNITB & PTA Boost AI, Gaming, Telecom & Cybersecurity Sectors56Seven NCCIA Officials Resign Amid Bribery ScandalLahore Court Extends Remand of NCCIA Officials in Ducky Bhai Bribery CaseFIA Says ‘Missing’ NCCIA Officer Was Hiding to Escape InquiryNCCIA DG Waqar-ud-Din Syed Transferred Amid Money Extortion AllegationsFIA Gets Remand of NCCIA Officers in Ducky Bhai Bribery CaseFIA Books 9 NCCIA Officers for Allegedly Extorting Millions in Ducky Bhai CaseMissing NCCIA Officer Was Investigating Ducky Bhai Gambling CaseIHC Issues Ultimatum Over Abducted NCCIA Deputy DirectorNCCIA: Abductions of Officers from Islamabad and Lahore Continue# PSL# Made in Pakistan# sports# PCB# Ministry of Inter-Provincial Coordination (IPC)# FIFA World Cup 2026Explained: The real reasons behind Indian (Expected) withdrawal from Asia Cup 2025Mike Hesson confirmed as Pakistan Cricket Team’s new white ball Head CoachAlyssa Healy slams BCCI over chaotic IPL Evacuation: ‘Players Had to Run Barefoot’”PCB# IPL# India withdraw Asia Cup 2025# Babar Azam# PSL 2025# PAK attack Ind# Mike Hesson# Asia Cup 2025 controversy# Bbl S15# Ali Tareenhttps://t.co/S8aEYRLJucJuly 3, 2025disconnectAli TareenPSL 2025GBPAEDGBPAUDGBPCADGBPCHFGBPCNYGBPEURGBPINRGBPJPYGBPMYRGBPSARGBPSGDGBPTHBGBPTRYMinistry of Inter-Provincial Coordination (IPC)sportsNetflix Gears Up For Stranger Things Season 5: First Five Opening Minutes DroppedNetflix Introduces Viewer-Based Ad Metric as Global Reach Hits 190 MillionNetflix Explores Major Bid for Warner Bros. Discovery Studio & Streaming Assets# Netflix# Movies & TV Shows# TV & Movies# HBO# Wednesday Season 2# Naruto# anime# Spotify Update# Netflix AINetflix Goes ‘All In’ on Generative AI Despite Industry DivideNetflix Reaffirms ‘Build Over Buy’ Strategy, Rules Out Legacy Media AcquisitionsHBO Max Announces Major Price Hike in US: What It Means for PakistanA New Gen Manga Looking Poised To Surpass Naruto GloballySpotify Partners with Netflix for Video Podcast LaunchSpotify Video Podcasts Will Soon Be Available On NetflixHBO Max Launches in Pakistan with Rs. 7,700 Annual PlanApple TV+ Officially Rebrands to Just “Apple TV”X Launches ‘Bangers’ to Spotlight Viral Tweets and Top CreatorsMaharashtra Becoming First Indian State to Get StarlinkSpaceX Makes Significant Bitcoin Move Second Time in A Month, Raising Market EyebrowsSpaceX Moves Bitcoin, Raising Questions About Musk’s Crypto StrategyX Reports A Sharp Dip in Q2 Ad Revenue Despite Earlier MomentumX to Launch Fully AI Timeline by November 2025LHC Rules Netflix, Amazon Prime Exempt from Censorship in PakistanA Creepy PlayStation Game Just Became Netflix’s New NightmareTV & MoviesBlockbusterMovies & TV ShowsWednesday Season 2Amazon PrimeHow to Stop Unauthorised VAS Charges on Your Jazz NumberJazz Allegedly Charges Customers Without Consent: Consumer Complaints MountPakistan’s Fastest Networks Revealed in Ookla’s H1 2025 ReportSenate Panel Questions PTA Tariff Approval in Jazz CaseSenate Panel to Review Jazz Audit Report, Spectrum IssuesAn Indian Wants to Migrate to Pakistan: What Follows Is an Epic Reddit Suggestion ShowWhy AI-Generated Content is a Triple Threat for Reddit ModeratorsFortnite Players Outraged on Reddit as Epic Games Retracts PurchasesReddit Reveals Sports Engagement Strategy Fueling Fan CommunitiesReddit Reinvents Itself as a Search Engine with AI Tool ‘Reddit Answers’Reddit Rolls Out New Privacy Feature for User ProfilesWho’s Paying Creators the Most in 2025? Find Out How to Earn on YouTube, TikTok & MoreTelenor Pakistan Appoints Bilal Javed Bhatti as Chief Business OfficerTelenor Pakistan Exit Delayed: Final Deal Closing Pushed to 2026PTCL Group Reports 15% Revenue Growth Amid Strong Broadband and Enterprise ExpansionCCP Orders PTCL to Unbundle Operations After Telenor Merger ApprovalShoppingA Pakistani Schoolgirl Creates Hello Kitty Land with famous E-commerce BrandTemu Slaps 145% ‘Import Charges’ on U.S. Orders Amid Trump TariffsYouTube is Launching its First Official Shopping Channel in South KoreaLahore Police to File FIRs Against One-Wheeling Bikers on Social MediaPunjab Police Collect Rs.26M Traffic Fines in 24 HoursPunjab Fines 29,700 Drivers for One-Way ViolationsSindh Sets New Vehicle Age Limits and Safety RulesMotorway Police Crack Down on Cash Drop Fraud at Service AreasLahore Traffic Police Issue 37,000 Fines in AugustNearly 40% of Sindh Truck Drivers Have Vision ProblemsMajor Section of Karachi’s Lyari Expressway Closed for Development WorkPakistan Surges Ahead in Mobile App Development, Launches Over 1,000 New Apps in 2025Rising Pakistani Star Joins Google as Gaming Industry LeadMany of Punjab IT Board’s mobile apps have been bombarded with negative reviewsOpera blamed for offering predatory loans through Android appsTehreem FarooqiIt’s Time to Delete All Other Apps from Your Phone!5 apps to download before leaving for HajjFaisal Saeed6 easy steps to clean your Android phone from virusFacebook to let developers monetize instant games on MessengerTerrorist group Ansarul Sharia developed mobile apps for highly secure communicationSnapchat Teams Up With Perplexity AI to Bring Conversational Search Inside ChatsSnapchat Makes AI Imagine Lens Free for U.S. UsersMajor AWS Outage Disrupts Fortnite, Canva, Snapchat and MoreSnapchat Unveils Next-Gen AR Tools, Monetization & Gaming Upgrades at Lens Fest 2025Snapchat Introduces Paid Storage for Memories After 5 GB Free LimitSnapchat CEO Details Surprising Upgrades & Future Growth PlansSnapchat Rolls Out Imagine Lens for AI-Powered Image GenerationSnapchat Says AI-Powered AR Lens Dramatically Boost EngagementSnapchat Sees Slowest Growth in Over a Year as Ad Error Hits RevenueNADRA Resumes Mobile Van Service Across Punjab DistrictsHonda Launches New Installment Plan for Civic 2025: Drive Now, Pay LaterStartupList.pkTechCrunchCrunchbase.pkfundingStartupAI glassesAlibabasmart glassesPIA is All Set to Resume Flights to UK This MonthEmirates Flight Reports GPS Malfunction on Approach to KarachiFIA, CAA & Airlines Unite to Speed Up ImmigrationIslamabad Airport Flight Suspension Announced Ahead of Independence DayAir Arabia Secures Approval for New Routes in PakistanPIA Flight from Karachi to Lahore Lands Without One Rear WheelZeroAvia Moves One Step Closer To Hydrogen-Powered Test FlightsPakistan to launch three new airlines soonSereneAir adds two new Airbus-A330s to its fleetARC Raiders Beats Battlefield 6: Steam’s 3rd Most Played GameNVIDIA’s GeForce NOW to Add 23 New Games This MonthBattlefield 6 Leak Reveals Nine New Game Modes in Development# Tekken 8KATSEYE x VALORANT: Game Changers 2025 Anthem RevealedGTA VI Delay Could Cost Rockstar $500M: New Estimate EmergesElden Ring Nightreign DLC Confirmed by Kadokawa by March 2026Marvel Boss Hints at More Superhero Games After WolverineK-Pop Demon HuntersFortnite x The Simpsons: Get Kang and Kodos Glider For FreeFortnite Sidekicks Are Here: Peels, Bonesy, Lil’ Raptor and CATS!!!Fortnite x The Simpsons: Bart Simpson Skin TeasedFortnite x Resident Evil Requiem: Officially Announced for 2026Fortnite Winterfest Testing Kicks Off with High Hopes for Holiday ExtravaganzaFortnite to Buff Thorn Ripper, Hand Cannon & Wood Stake ShotgunFortnite Crew Pack Revealed: Maxx Speed Joins the RaceAll Story and Weekly Quests Coming to Fortnite Chapter 6 Season 4Fortnite x The Simpsons Collab: Live Event and Update ConfirmedFortnite Leak Reveals Simpsons Springfield Map for Next SeasonTwo New LEGO Fortnite Brickheadz Officially RevealedFortnite Scooby Gang Run Emote Drops with Fortnitemares 2025Doja Cat Slams Fortnite Over “Cringe” Fake Post After Social Media Takeover StuntLeaks Suggest Fortnite is Making a Special Halloween CollaborationPopular Horror Video Game Set to Receive Movie AdaptationSteel MillsHassan AbdalLoad SheddingSNGPLongoing theft investigations at the millsPakistan Steel Mills (PSM)Islamabad High Court (IHC)Islamabad Traffic PoliceHRCPLabour UnionAnti-Smog DriveLahore PollutionPunjab HousingPunjab Housing SchemeWorld Bank PartnershipPak Identity mobile appoverseas pakistanisPak Identity AppFESCO UpdateNEPRA PolicyPower sectorBusiness Bodies Urge NEPRA to Lower Industrial Tariff in PM’s Incremental Power PackageLESCO Upgrades to Smart AMI Meters and Tightens Net Metering RulesFederal Ministers and SAPM Discuss Upcoming Meeting Between Prime Minister Shehbaz Sharif and Top 20 CEOsNADRA Team to Visit Saudi Arabia to Facilitate Overseas PakistanisSenate Committee Criticizes Planning Ministry for Project Bias and Unequal DevelopmentNADRA Opens First Women-Only Center in South PunjabNEPRA Announces 48 Paisa Per Unit Cut in Power Tariffs NationwideNADRA Announces One-Day Closure of All Offices on November 9Govt Enforces 10% Women’s Job Quota Across Federal DepartmentsCourt Moves to Tackle Lahore Air Quality CrisisPIA Restores Operations After Major DisruptionsIESCO Imposes Rs13.6 Million in Fines, Arrests 42 Over Power Theft in OctoberUN Says 2025 Could Rank Among the Hottest Years Ever Recorded870Punjab Govt Approves Rs. 18 Billion Water Projects for RawalpindiNet Metering Units in Pakistan Jump 28% in September 2025Visa and HBL Relaunch ‘She’s Next’ in Pakistan to Empower WomenPakistan Secures Bid to Host ASOCIO Digital Summit in November 2026SNGPL to Temporarily Suspend Gas Supply in Five Islamabad Sectors for MaintenanceMinerals Division Proposed to Overhaul Pakistan’s Gemstone SectorMajor Motorway Project in Sindh Likely to Begin in Early 2026FIA Dismisses Rumors of New Travel Restrictions for Overseas WorkersElectricity Prices Likely to Rise by 45 Paisa in Quarterly AdjustmentSEPCO Proposes Rs1,000 per kW Fixed Charge for Net Metering UsersPIA Dismisses SAEP Officials Over ProtestTrump Repeats He Stopped India-Pakistan War After ‘Eight Planes Were Shot Down’Muhammad Amir Malik Appointed to Lead Global Tech Initiatives at IT MinistryPTA Chairman Unanimously Elected as the Head of SATRCPTCL Group Advances Global API Innovation with CAMARA Standard under GSMA Open Gateway Initiative at GITEX Global 2025PTCL Privatization Dispute Enters New Phase as Etisalat and Pakistan Seek SettlementPakistan’s Internet Still Sluggish Despite Recovery EffortsNational Assembly Committee Discusses PTCL Property Deal, Delays Digital Media 2025 BillPTCL Group Expands Partnership with Mercantile at GITEX GLOBAL 2025 to Offer Apple’s Full Product RangePTCL Social Impact Initiative, ‘Dil Se’ Wins Gold at ‘Dragons of Asia’PTCL, PPAF Expand Ba-Ikhtiar Initiative to Empower 2,300 Women Across PakistanPTCL-Telenor Merger Delay Stalls Pakistan’s 5G Spectrum AuctionSenators Question Pakistan Crypto Council’s LegalityDecision on LDI License Renewal Likely After EidMobilink Bank wins GLOMO Award for ‘The Invisible Heirs’ CampaignFBR Turns a Blind Eye as Wateen Telecom Ltd Issues Reduced Tax CertificatesGovernment Faces Backlash for Halting Senator’s Pro-Crypto BillRevoking LDI Licenses Could Impact ATM and Internet AccessPakistan’s 5G Launch Gets Delayed Once AgainPTA Cracks Down on Multiple Illegal Internet Providers in PakistanPTA Received Over 17,000 Complaints Against Telecom Operators in March 2023Zoom Gets Licence to Provide Telecom Services in IndiaPakistan’s 5G Launch Might Get Delayed AgainPTA Conducts Another Successful Raid Against Illegal SIM CardsPTCL and Telenor Merger Aims to Transform Connectivity in Pakistan: Hatem Bamatraf at GITEX GLOBAL 2025Fueling the Throw, Igniting a Nation: Arshad Nadeem’s Relentless PursuitUfone Faces Scrutiny in Senate Over Losses, Spectrum ShortageOnic Celebrates Two Years of Redefining Pakistan’s Digital Telecom ExperiencePTCL Expands Strategic Partnership with Teradata to Strengthen Data & Analytics CapabilitiesPTCL Faces Rs. 7.2B Loss Despite Revenue GrowthUfone Faces PTA Scrutiny Over Customer Service ShortcomingsBook Ufone 4G Number Online and Get Exclusive RewardsJazz, Zong & Ufone Unite to Support Flood-Hit Communities in KP & AJKPTA Report: Jazz and Zong Top Complaint List in June 2025Z SAIS Cloud by Zong Debuts as Pakistan’s First AI-Enabled Cloud PlatformPTA Slaps Zong With Enforcement for $11.77 Million DuesZong Records Highest Billings Complaints, PTA Survey RevealsPakistan’s 5G Auction Stalled by Zong’s Legal Moves, Costing Over $200 MillionZong Fined Rs68.9 Million as PTA Cracks Down on Peshawar’s Poor Telecom ServicesJazz Records Highest Telecom Complaints at 4,987 in February 2025, Ufone Lowest at 1,435LDI operatorsmergerTelenor AsiaJazz Posts 14.6% Revenue Growth in Q3 2025 on Back of Telecom and Digital Services ExpansionPM Shehbaz Urges Acceleration of Pakistan’s MVNO Framework as Delays Stall Telecom ProgressPakistan’s Telecom Market Faces Ongoing Subscriber Drop Despite 4G GrowthInternet and Cable Operators Protest LESCO’s Cable Cutting DriveLawmakers Clash Over Delays in Islamabad IT Park and Poor Internet Service Across PakistanLESCO’s Cable Cuts Cause Major Internet Outages Across LahoreGovt Confirms Cellular Service Issues, Plans 5G Rollout in PakistanPTA Suggests Rs.72 Billion LDI Dispute Nearing Resolution as NA Panel Questions MOITT’s RolePTCL Confirms Internet Speed in Pakistan Restored After Submarine Cable RepairUAE Hits 145 Gbps in 6G Terahertz Pilot: A Major MilestoneTelecom Sector Gets First-Ever Green Sukuk in PakistanPTA Blocks thousands of Illegal Sims as Crackdown continuesPTA Introduces Free WiFi Hotspots for Students Across These UniversitiesGovt to block 5 Million SIMs linked to expired CNICsTelenor’s services now available 24/7 at self-service boothsPakistan’s most affordable 4G phone launched with the collaboration of Telenor and QMobileZTE no longer serving Pakistani Telecom companies following US banPakistan’s first Game Summit ‘Gamebird’ hosted by TelenorGovt to finalize telecom tax for Budget 2018-19Zong offers new services in its concept storesPTA has blocked 0.4 million porn websitesFiber optic expansion project worth Rs 2 billion approved by govtMuhammad Naveed appointed as the new Chairman PTAHigh Court allows suspension of cellular services in the countryPakistan’s telecom sector has expanded significantly in four yearZong 4G hits more than 6 million 4G subscribersHow to avail free Netflix subscription on PTCL Internet Packages63Telenor IoT hackathon concludes successfully. But it is just the beginning!NADRA, Police and Telcos data being sold publicly on FacebookPTA approves investment in telecom infrastructure services companyBudget 2018-19: Govt proposes PKR 66 billion for Science & Technology sectorDucky BhaiGambling Appslatest Android beta versionTelegramA post shared by Instagram (@instagram)RingsIndonesiaProtestsBluesky Hits 40 Million Users: Impressive Milestone or Major Miss?Pakistanis Downloaded 3.56B Apps in 2024, Yet Local Development StallsMeta will Soon Use Your AI Chats to Shape Ads and RecommendationsThreads Might Be Quietly Hiding Hashtags in Cross-Posts to Clear Up FeedsApple Eyeing Perplexity AI Amid Growing AI Arms RaceSalaried Class to Receive Significant Tax Relief, Says Finance MinisterAMD Leaks Ryzen 5 9600X3Dv Entry Level Gaming King?Adobe Indigo Offers DSLR Quality Images on iPhoneNADRA unveils Sweeping changes to CNIC & Birth RegistrationsBBC Threatens legal action against AI firm PerplexityAuto Sector Deems Govt’s Proposed 30% EV Share by 2030 UnrealisticPakistan Plans To Lease Ships, Aims For $4 Billion Forex FixPakistan’s Sugar Saga: Why Importing Sugar After Record Exports?Govt Confirms Latest Taxes: Rs. 2.5 per Liter Carbon Levy & New EV ChargesHonda’s Rocket Launch: Joins Space Race Out Of NowhereWhatsApp Launches Official Apple Watch AppWhatsApp Introduces Passkey Encryption for Chat BackupsWhatsApp Storage Update Adds Better Tools to Manage Large FilesWhatsApp Targets Spam with New Unanswered Message LimitsU.S. Court Bars Israeli Spyware Maker from Targeting WhatsApp UsersWhatsApp Adds Call Scheduling Feature, Pushes Into Smarter CommunicationPunjab Govt Issues New Social Media Rules for EmployeesInstagram Brings Reels Watch History: Never Lose a Meme AgainInstagram Brings Meta AI Editing Tools to Stories for Smarter VisualsInstagram Implements Tougher Content Restrictions for Teen AccountsTikTok Deal Still Not Anywhere Close to Final, Despite Trump-Xi MeetingTikTok Removes Over 25 Million Videos in Pakistan for Guideline Violations in Q2 2025OpenAI Has Officially Launched Their TikTok-Style Social Media AppOpenAI May Launch Social TikTok-Style App Powered by Sora 2TikTok Algorithm to Be Licensed; U.S. Gov Says “Won’t Have A Stake”YouTube Deletes Palestinian Rights Channels Under US SanctionsYouTube Tightens Rules on Gaming Videos Featuring ViolenceYouTube Lets Creators Opt Out of Live-Stream LeaderboardsYouTube Hits $8 Billion in Music Industry Payouts, Expanding Its Global ReachYouTube Restores Services After Global Outage That Disrupted Video StreamingIrfan Junejo to Collaborate with FC Barcelona SoonYouTube to Pay $24.5M in Trump Account Suspension SettlementSpotify’s New Feature Let You Track and Share Your Top SongsPinterest Introduces Voice-Enabled AI Search Assistant for Visual Discovery179Punjab Police Register Three Cases Under PECA for Deepfake Content Targeting CM Maryam NawazSpotify Teams Up with ElevenLabs to Expand AI-Narrated AudiobooksHow to Detect and Remove Stalkerware from Android Phone?10 Facebook friends who rule your Facebook wallsViral Pakistani Video fools people into removing NFC chips from phones10 video proofs of why everyone is down with Dubsmash feverAmna MishalBrace yourselves: Animated gifs are coming to Facebook10 responses from Pakistanis to Mark Zuckerberg’s post about Internet.org launch in PakistanFacebook is testing Name Pronunciation featureDebunking the myth of Sexiest Men and World’s most beautiful Capital City – Never trust the social media!Mark Zuckerberg post with a controversial map anger Indians.Facebook Launches Instant Articles: A Faster Way To Read Your Favorite Content On Your SmartphoneFahad UllahCyber Crime Law of Pakistan – Mythbusting the Prevention of Electronic Crimes Act 2015Fatima A. AtharWhich country is most addicted to Facebook? No, It’s not Pakistan or USANow Facebook Can Learn About You From Your Videos!Facebook’s New Suicide Prevention Tool: Can this really work?Sadia Arshad171172174175Google is finally bidding farewell to Google+Reid Hoffman reluctantly admits LinkedIn website needs improvementTake these 5 precautions against these 5 Facebook hacking methodsBramerz celebrates Mashable’s Social Media Day in PakistanDOGE,DogecoinBinance CoinBNBTetherETH-PKRETFsETFSOL-PKRCardanoPolkadotBitcoin surgePi Coin Surges as Pi Network Links Up with ISO 20022 Banking StandardBitcoin Slips to $112K Amid U.S. Fed Rate Cut Uncertainty and Trump-Xi Trade TalksBitcoin & Ethereum Surge Briefly as Macro Factors AlignBNB Dominates ‘Uptober’ Amid Binance Scrutiny and Market TurmoilBTC Faces Cautious Calm Before CPI Report: Macro Storm BuildsMan Loses $850,000 in Alleged Crypto Theft at Karachi Airport, Court Orders InquiryIf you can’t handle Litecoin dropping to $20, don’t buy!, Litecoin founderCoinbase halts Litecoin & Ethereum trading as prices massively fluctuateDesigner visualizes new Bitcoin logo and it looks very neatBitcoin to reach 100,000 dollars by the end of 2018, expert traderCoinbase warns users to invest in cryptocurrencies responsiblyCoinbase beats Facebook & YouTube to become the most downloaded app on iOSHackers stole over $60 million in users’ funds from crypto mining service NicehashBank of America gets patent for exchange system of cryptocurrency“Bitcoin is un-Islamic”, says Turkey’s religious authorityBitcoin crosses historical $12,000 markThese 2 incidents can bring the value of Bitcoin back to 1000 dollars, expertBitcoin Bubble Burster will tell you when Bitcoin is about to crash72Breakthrough in Quantum Teleportation May Redefine the Future of the InternetEngineers Build Universal ‘Translator’ for Quantum ComputersQuantum Computing Is Threat To BTC: BlackRockQuantum Computing Opens a New Gateway For ScienceJapan’s New Quantum Computer Debuts with 256 QubitsHey SiriSiriMobile OperatorsApple Extends Free Satellite Trial Access for iPhone 14 and 15 UsersApple Revamps Battery Settings in iOS 26 With Smarter Power ToolsApple Significantly Boosts Forecast for Folding iPhone ShipmentsLeak Suggests iPhone 17 Pro Max and Base Model Will Keep Current PricingNon-PTA Phones’ Sims Start Working on Pakistani Networks?Apple iOS 26 Beta 5 Is Almost Here, Eligible iPhones You Need to Know AboutiPhone 17 Pre-Orders: Key Details and ExpectationsApple iPhones May Soon Get iPad Pro’s Advanced Tandem OLED DisplayiPhone 17 Pro Expected Without Reverse Wireless Charging SupportApple Confirms Official Launch Date For iPhone 17Apple to Remove Camera Control Button in Upcoming iPhone 18Vivo S50 Pro Mini may Ditch MediaTek for Snapdragon ChipsetiQOO Officially Reveals Chipset For Neo11Vivo’s Upcoming S50 Series Packs Flagship FeaturesiQOO Neo11 Launch Date Confirmed in China as Leaks Reveal Key DetailsVivo iQOO 15 Breaks Sales Records Within Minutes of LaunchVivo X300 Series Breaks Sales Records After China LaunchiPhone 17 Series Cases Leak Days Before Apple’s September 9 EventiPhone 17 Series Screen Protector Leak Reveals Models’ Display DifferencesReports Hint iPhone 17 Pro Will Offer 256GB Starting StorageApple iPhone 17 Launch Event Gets Rumored Official DateApple iPhone 17 Pro May Launch in a Bold New Orange ColoriPhone 17 Pro Leak Reveals Bold New Camera Bar DesignWhatsApp Beta Update Adds “Ask Meta AI” for Smarter Message RepliesApple iOS 26 Brings Polls to Messages App With Up to 12 ChoicesiOS 26.1 Update Brings Apple Intelligence to More Languages WorldwideMove Over Liquid Glass: iOS 26 Unveils 3 New Power-Packed FeaturesApple Maps Quietly Gains Powerful Natural Language Search in iOS 26 BetaApple Sues Tech YouTuber Jon Prosser for Leaking iOS 26 DetailsTECNO Brings Power into Budget with Spark 40 and Spark 40CTECNO Spark 40C Launched in Pakistan – Big Battery, Stylish Design, and Everyday ReliabilityTECNO Spark 40C to Launch in Pakistan With Big Battery & Powerful FeaturesTECNO Spark 40 Series Leak Hints at Launch Date and Smart FeaturesiPhone 16eiPhone 16 familymarket analystsiPhone 17e leaks# xiaomi mobiles# Oppo mobileHonor GT 2 Series Tipped for December Launch with Snapdragon ChipsetApple iPhone 17 Series Global Pricing & Pre-Orders DateEverything Apple Announced at the Event: iPhone 17, Apple Watch, AirPodsApple Officially Launched iPhone 17 Series, Watch the Announcement Live HereSony Xperia 10 VII Nears Launch as Specs and Images Leak OnlineInfinix HOT 60 Pro+ Launched in Pakistan, Priced at PKR 59,999Apple Prepares for a Landmark Reveal: iPhone 17 Series at “Awe Dropping” EventXiaomi 15T and 15T Pro Launch Officially AnnouncedArattai App Becomes India’s Booming Alternative to WhatsAppTikTok Rolls Out New Parental Control FeaturesIs Pakistan Considering Putting An Age Limit to Social Media Access?PTA Blocks 105,296 Blasphemous Links on Websites and Social AppsPakistani Social Media Accounts Blocked in India Again After Brief RestorationWhat Are Pakistanis Watching on Netflix in June 2025, And Should You?NCERT Issues New Advisory on Responsible Social Media Use in PakistanTikTok Rolls Out New Feed Personalization ToolsNational CERT Dictate Parents on Safe Use of Social Media for ChildrenSenate Panel Grills PTA on Online Anti-State PropagandaNew WhatsApp Username PIN Feature To Curb Unwanted Messages24BlizzardOverwatch 2Babar AzamBbl S15Cricket AustraliaChery Tiggo 9 C-DM Hybrid Launched in China, Pakistan Launch Expected SoonGovt Reverses Proposed Sales Tax Hike on Hybrid CarsHybrid Car Prices to Rise Sharply After Budget 2025 GST HikeGovt Plans Drastic Reduction in Solar Net Metering RatesAcer New Bike Desk Lets You Charge Your Devices From Pedaling While Working4000 New CCTVs To Be Installed on Rawalpindi Roads to Monitor All City Areas.King Charles III Presents Member Of The Order Of The British Empire Award To A Pakistani EntrepreneurTurkey Restores YouTube AccessNada Zaininvest2innovate Is Now Accepting Applications For Its 3rd CycleWhat happened at Apple Keynote: WWDC 2014Zain PerachaPakistani startup secured 1st Runner up position at Angel Hack DubaiToday we are announcing StartupJuiceHomeshopping.pk down for over 12 hoursPakistani Youth to Participate in Global IT Competition – IT World Certiport 2014eLearn Punjab – Pakistan’s First Online Repository of Free TextbooksApple Confirms $3 Billion Acquisition of BeatsSehat – Get Medicines Delivered to your DoorstepLeaked Photo Shows Galaxy Tab S AMOLED DisplayPredictions & Rumors about Samsung’s Next SmartwatchUfone Launches 3G Service Commercially855856858859Facebook Page of Laal Band Gets Banned in PakistanBlackBox Connect Fall 2014 Applications are now open!Android v4.4.3 KitKat OTA Update Now Rolling Out for Nexus, GPE DevicesSlight Tax Reduction on Telecom Services in Budget 2014-15Twitter/X Link Outage in Pakistan Sparks Censorship ConcernsX/Twitter, Rolls Out AI Community Notes – Should Users Trust Them?X Outage Disrupts Logins and DMs for Second DayX Outage Affects Global Users; Hillsboro Fire Possibly LinkedTwitter’s Iconic Blue Bird Logo ‘Larry’ Returns to Auction with Estimated $40,000 ValueElon Musk’s X Restricts Links to Signal Messaging AppElon Musk Renames OpenAI’s Sam Altman, and It’s Not a ComplimentMalaysia Approves Licenses for WeChat and TikTok Under New LawIran Restores Access to WhatsApp and Google Play StoreIndian Govt Blocks 28,000+ Social Media URLs in 2024Bluesky Attracts 700,000 Users in a Week Following US Election“Husband storage facility” introduced in ChinaFederal Ministry launches an SMS service to prevent Haj fraudFacebook declines Government’s request to link Accounts and Phone NumbersGovernment launches a website for stolen and lost mobile devicesPakistani Citizens will soon be able to apply for driving licenses onlineBanned Organization still working online in PakistanSnap share just went below its IPO priceElon Musk reveals the first photo of Tesla Model 3Stable version of serving robot launched in PakistanPakistan Post launches Cash on Delivery across the countryHEC allocated Rs 2.763 billion for two new university colleges in BalochistanToyota testing out car steering wheels that can detect heart attacksPakistan set to be the first country to test 5G technologyelectric bikeElectric bikesFaysal BankIslamabad Expands Vehicle Emission Testing to Four LocationsPunjab Citizens Can Now Turn Phones Into Safe City CamerasPakistan Railways Launches Greening Drive Along TracksLDA Starts Underground Parking Plaza at Nasser Bagh Amid Heritage ConcernsPakistan to Lead ECO Council of Ministers in 2026–27 TermQR Code Payments Introducing to LCCI as SBP Pushes Digital ShiftFinland Announces Closure of Embassy in Pakistan in 2026RAM Prices Spike Globally, 64GB DDR5 Now as Expensive as PS5 ProSindh Issues New Winter Rules for Private Schools Banning Mandatory JacketsFIA Arrests 20 in Multi Billion Stamp Paper Scam in PakistanBeaconhouse’s SOT XIX Day One Concludes, Showcasing Thought Leadership on Humans, AI and an Equitable FutureRDA Launches Transparency Drive With New Signboards in University TownPakistani Startup WonderTree Bags GSMA’s ‘Impactful AI’ GrantWorkplace HarassmentJJVL Restarts Operations, Sends First LPG Shipment After 5.5 YearsPetrol Prices Set to Drop in Pakistan From December 1 After Global Oil DeclineGlobal RAM and SSD Prices Surge Sharply, 64GB Memory Costs as Much as PS5 ProTech Valley Pakistan brings Free Google AI Pro for HEC StudentsPewDiePie Officially Quits YouTube Gaming After 13 YearsGhandhara to Launch Locally Assembled Luxury Buses in PakistanCCP Issues Notices to Punjab Sugar Mills Over Price FixingGold rates Pakistan todayTurkish Construction Giant Eyes Major Investment in PakistanGITEX 2025SOT XIX 2025 Beaconhouse Summit to Feature Over 100 Speakers on AI and Future Co-CreationWECON 2025 Masawaat Conference Calls for a New Era of Equity in Pakistan’s Entrepreneurship LandscapePEFPunjab to Make Teaching Licenses Mandatory for All School Teachers in 2026Punjab Extends Admission Deadline for Matric Exams 2026 Across All BoardsFBISE Class 9 & 10 Second Annual Results 2025 AnnouncedKP Schools Update Timings for Fog Safety in Four DistrictsNew Android Dual-Band Hotspot Maximises Speed & CompatibilityOpenAI and Google Quietly Slash ‘Sora’ and ‘Gemini’ Free LimitsIs Black Ops 7 Still Using Skill-Based Matchmaking? Treyarch RespondsGoogle Updates Gemini 3 Pro Free Access Limits Amid Rising DemandOpenAI Moves to Defend Itself as Court Probes ChatGPT’s Role in Teen’s DeathChina Surges Ahead of the United States in Global Race for Open AI ModelsPrestigious Bicester Collection Prize Goes to Six South Asian Women InnovatorsUAE Visa Issues Intensify as Pakistanis Face Elevated Rejection RatesiQOO 15 Receives First Global Software Update Following International LaunchApple Lifts China’s Singles Day Sales as iPhone Demand SurgesSolar energySOLSouth Korean Crypto Exchange Hit by Major Exploit Only Days After Closing $10.3B DealBitcoin Short-Squeeze Momentum Builds with Funding Rates Turning NegativeBitcoin Holds $80,000 as Market Eyes Recovery on U.S. Liquidity ChangesBitcoin Takes Center Stage in Today’s Crypto UpdateVehicle SafetyGITEXExpand North Star 2025https://t.co/D0Gd11rgfyhttps://t.co/XPbcIycReJpic.twitter.com/qEtZtREcRVOctober 12, 2025AvatarUpcoming Games 2025ARC Raiders Ditches Health Bars: ‘Physics Creates True Immersion’Epic Games Brings Back Fortnite ‘Arcane Skins’ After 1,393 DaysCall of Duty: Black Ops 7 Slashes Prices for Black Friday WeekendPakistan’s economyPunjab EconomyGold and Silver Prices in Pakistan Today, 29th November, 2025China’s Diversified Investment in Pakistan Signals a Major Economic ShiftLive StreamsOTT PlatformsGoogle Appoints Farhan Qureshi as Regional Director for PakistanScientists Manage to Create Stretchable Solid-State Battery That Can Reshape EVs and WearablesPink Scooty Scheme#PinkScooties#PublicAlertpic.twitter.com/8uXei0QlQzfake newsPink Scooter Scheme“Delete Facebook” Calls Grow as Meta Rolls Out AI Privacy UpdateLinkedIn Rejects Claims Its Algorithm Favors Men Over Women After Study Sparks BacklashMeta Moves to Block All Third-Party LLM Chatbots From WhatsAppAtlas Honda Officially Launched CG150 and New Electric ScooterAtlas Honda Bikes Achieves Record Profit on Rising SalesTikTok Creator Rewards Now Live in Pakistan: Monetize Your CreativityPakistan Moves to Digitalize Overseas Employment Payments and Crack Down on ExploitationPTA Intensifies Crackdown on Illegal IMEI Tampering and Sale of Cloned Mobile DevicesNo Laws to tackle Cyber Enabled drug trade in Pakistan, Govt admitsPakistan Cracks Down on Illegal Call Centres, 500 Arrested in 5 YearsPakistan Announces Two Public Holidays in December 2025Senate Panel Proposes Two CSS Exams Per Year, Age Limit Raised to 35Pakistan, Turkiye Move Toward Stronger Energy and Mining PartnershipPakistan Inflation Hits 6.15% in November 2025 Amid Easing Food PricesAir Link Forms ZEXO Technologies to Boost Tech Manufacturing in PakistanPVARA at 120 Days: Is Pakistan’s Crypto Regulator Stuck in A Limbo of Its Own Making?Stylers International Gains Shariah Certification from SECPIslamabad Enforces Strict Action on Smoke Emitting VehiclesdistributionElectric rickshawPAVE SchemeAtlas Honda Launches HR-V Hybrid SUV in LahoreHonda Bike Price in Pakistan Sees Shocking Hike – CD 70 & CG125 Latest Rates RevealedAtlas Honda Set to Roll Out Electric Scooter for Pakistani MarketHonda CD70 Now Available for Rs. 6,448/Month via Faysal BankAtlas Honda Sets New Motorcycle Sales Record in May 2025Honda HR-V 2025 now available in Pakistan with easy InstallmentsGold and Silver Prices in Pakistan Today, 1st December, 2025Petrol Price Reduced by Rs2 per Litre from December 1Pakistan and Denmark Strengthen Cooperation in Trade, IT, and Renewable EnergySteady Cotton Rates Observed Across Major Pakistani ProvincesPakistan Targets Stronger Trade With Egypt Through 250 Business SelectionBitcoin Holds at $91K as Analysts Warn Bounce Lacks Real StrengthPakistan’s Innovator Shines in Bicester Collection Prize Awarded to Six South Asian WomenCrypto Markets Crash on Renewed Sell-Off as Bitcoin and Altcoins Dive DeepElden Ring on Sale Just in Time for December 4 DLC LaunchNew GTA VI Leak Reveals In-Development Gameplay MechanicsinitiativeallottedPunjab TransportPunjab Seizes 12,000+ Vehicles in a Day Under New Traffic CrackdownRawalpindi Set to Begin Rs. 8 Billion Underpass Project in JanuaryAI StartupHealthTechGDG Islamabad to Upskill 700+ Developers as DevFest 2025 Kicks Off With Major AI and Cloud PushhackingnetworkingMoITT Launches $77M Cybersecurity Revamp in Collaboration with World BankSmartTube Malware Threat Fixed: Android Users Urged to Update NowSECP Flags Two Fake Trading Platforms for Impersonating Legit BrokersWorld Bank to Restructure Pakistan’s $970M CRISP ProgramHow Elon Musk’s “WTF” Moment With Nikhil Kamath Turned Into Classic Indo-Pak Pain PointFortnite Chapter 7 ‘Pacific Break’ Live! Here is All You Need to KnowARC Raiders Still Dominates Steam Charts One Month After Launch#Islamabad#Rawalpindi#ChampAlertsOnTheGoOctober 13, 2025School holidaysTikTok Ads Manager Pakistan Launch 2025Agriculture SectorFertilizer EarningsKP Introduces Law to Protect Rs380 Billion Street EconomyPakistan Invites Elsewedy Electric to Expand Its Investment Footprint in Mining & ITTikTok Ads Manager Launch in Pakistan — A New Era for Digital MarketingDeutsche Bank Announces New CCO in PakistanBitcoin Could Reach $50,000 This Year and $120,000 By End of 2024: Standard CharteredBitcoin Could Fall 70% To $5000 In Possible 2023 ‘surprise’ :Standard Chartered PredictsStandard Chartered contributes the largest Urban Forest in KarachiStandard Chartered Bank and TPL Trakker collaborate to secure Auto-Financing solutionsSeven women-led companies in Pakistan win Rs. 1.5 million in seed grantsStandard Chartered bank account holders can now verify their biometrics by simply using this appStandard Chartered announces PKR 12.1 Billion profit over 9 monthsStandard Chartered to roll-out biometrics in Pakistan by the end of 2016Standard Chartered is rolling out video banking starting with AsiafinanceEarly lab prototypessolar panelsScientists Develop Implantable Closed Loop Insulin Pump for Improved Diabetes CareChina Races Ahead with Solid-State EV Batteries that Could Outperform Global RivalsScientists Make AI Tool That Cuts Emissions 45% and Extends Server Life by 20 MonthsUS Lab Makes Dual-Material 3D Printing Method for Aircrafts, Energy TechThis Material Can Be 3D Printed For Bone Graftspakistan internetMoITT Seeks Firms for National Fiberization & One-Window PortalPTA Proposes Mandatory Rollout Targets for TIP LicenseesTelenor Market Share Drops as PTCL Merger Enters Final PhasePakistan Activates SEA-ME-WE 6, Officially Connecting to One of the World’s Fastest Undersea CablesCloudflare Outage: How Fragile is the Foundations of the Internet?Nvidia, Discord Debut Try-Before-You-Buy Fortnite Gaming DemosDiscord Unleashes ‘Orbs’: Now Earn Rewards for Watching AdsDiscord’s Latest Update Brings New Themes, Faster Overlay, and Enhanced Features!Discord Considers IPO as User Base GrowsSkype is Shutting Down: Here’s How to Switch to Teams or Find a Better Alternative!Discord Will Soon Make You Change Your UsernameDiscord to Soon Introduce an AI Powered ChatbotDiscord faces a major outage for nearly two hoursDiscord isn’t interested in being bought by Microsoft (or anyone else)Microsoft to buy Discord for over $10 billionImmune SystemPakistan Forex Rates Today – NBP Issues Exchange Bulletin for December 1, 2025KSE-100 Rebounds Nearly 800 Points as Market Sentiment StrengthensPunjab Announces New Industrial Estate Near Ring Road to Boost ManufacturingLeak Reveals New Dead Rising Game: ‘Frank’ Takes on HollywoodCDA Seeks Relief for Islamabad Hotels and Motels With Reduced Commercial ChargesPakistan Faces Nationwide Internet Slowdown as Nayatel Reports Major Upstream OutagePakistan Eyes 2035 for Moon LandingPakistan-China Remote Satellite Launching on THIS DateChinese Cable Company Explores Pakistan’s Fiber Broadband MarketPakistan, China Set Up Joint Agricultural Science LabChina Approves Partial Rescheduling of $1.8 Billion Debt for PakistanChina-Pakistan Partnership Brings Jobs for Skilled Pakistani YouthPakistan’s Stealth Jet Deal Leaves India on Edge50,000 Chinese Investors Show Interest in Gilgit-Baltistan ProjectsIT Minister Advances Pak-China Tech Partnership in Key Meeting with EnvoyUNDP and China Launch Climate Early Warning System Project in PakistanPakistan Astronaut Mission Set for Launch with China’s SupportChina plans to introduce electric cars in PakistanPakistan to get $8 billion loan from China to upgrade RailwaysCERN finds an Innovative way to “Transport” AntimatterPakistan contributes significantly to CERN’s Large Hadron ColliderCERN is planning to build a $23 billion 100-kilometer long super-colliderFirst Pakistani female student gets selected for international training at CERNSameed Muhammed, a Pakistani physicist, is part of the CERN team that made a breakthrough discovery on antimatterI am a Pakistani & this is how I made my way to CERNSameed MuhammadThe World’s largest machine shut down by a tiny animalPakistan Launches First Hyperspectral Satellite HS-1 from ChinaPakistan to Launch First Hyperspectral Satellite HS-1Pakistan’s IT Exports Hit $3.8 Billion as Govt Pushes Digital ExpansionPakistan’s New Remote Sensing Satellite: Capabilities and Impact ExplainedPakistan Expected to Boost Space Program Funding in the Budget 2025/26BREAKING: Likely Date for Eid ul Azha 2025 in Pakistan Announced!SUPARCO Calls on Scientists and Students to Join Pakistan’s First Space MissionReno14 seriesReports suggestOppo mobileOppo Reno 14 seriesHonor Magic 8 Pro Debuts Globally With Massive Battery and Improved CameraSam Altman says New OpenAI Device is Peaceful, Unlike the iPhoneAnthropic Unveils Opus 4.5 With Record-Breaking Coding Skills & New IntegrationsGoogle Unveils WeatherNext 2: AI Weather Forecasting at Unprecedented ScaleThe AI Disruption Continues: How Generative Intelligence Is Redrawing the Landscape of WorkAI in Games: If We Don’t Embrace It, We’re Selling Ourselves ShortAI-Powered Eye Implant Enables Reading Again in Blind Patients1 in 5 Games Now Built by AI: Inside the Industry Upheaval Changing the RulesTraffic Signals on Dashboards: Dubai’s Smarter Roads PlanSocials AppsOPPO A6 4G Launches in Pakistan: Power That Lasts, Performance That Wins, Camera That InspiresPhotonicsMajor European Country Resumes Visa Services in IslamabadPakistani Scientist Won Best Presentation Award At A European Event In SerbiaSindh govt plans to set up an Information Technology board just like Punjab’s PITBFirst ever Nordic Pakistan IT Summit held in StockholmSweden to become world’s first cashless societyPakistani wins Sweden’s most prestigious innovation award for a device to help the elderlyPakistani-Led UAE Startup Secures US$4.5M to Deploy AI Agents for CybersecurityPakistan Unveils Its First Locally Built Secure Phone for Government OfficialsNew “Shield System” Empowers Drones to Defend Themselves Against CyberattacksPakistan Advances Financial Cybersecurity with PCI DSS Compliance TrainingOperation Grey: Under Reported U.S. Pressure, Pakistan Cracks Down on Scam Call RingsDanny de HekCybersecurity Blunder Ends 158-Year Legacy, 700 Workers AffectedCybersecurity Insurance Set to More Than Double by 2030. Are Pakistani Firms Ready?Microsoft Issues Emergency Patch for Critical Windows FlawPak Ramps Up I.T. Policy as Minister Vows Cyber Training for KidsTech Risks and Compliance: What Should Firms Expect in 2025?The AI-Powered Ransomware Era Is Almost HereUS House Bans WhatsApp Citing Data Security RisksDisaster ManagementPakistan FloodsChina’s New EUV Light Source Sparks Fears of Rapid Semiconductor DominanceTiny Robots Aim to Deliver Drugs Directly to Blood Clots & Tumors In A Promising New ResearchRobotic Recycling Breakthrough Aims to Revamp EV Battery LifecycleScientists Develop Artificial Neurons That Behave Exactly Like A Human BrainEngineers Unveil VoxeLite: A Wearable Patch That Lets You “Feel” TouchscreensScientists Develop AI Computer Chips That Operate At the Speed of Light# NASA# Quantum computing# Artificial intelligence (AI)Pakistani Astronaut to Join China’s Space Station Mission for Short-Term AssignmentScientists Edge Closer to Proving Existence of Dark MatterBiocomputing Revolution: Human Mini-Brains Power ComputersYouTuber Builds “World’s Smallest” FPV Drone; Just 22 mm Across!Scientific innovationTikTok Creator Fund Now Live in Pakistan: Monetize Your CreativityPakistani Scientist Recognized in Finland with €10,000 Young Researcher PrizeScientists Think Interstellar Object Might Be A Hidden Alien SpycraftScientists Develop Protein Coating That Blocks All Bacteria11 Science Ministry Institutions Operate Without Permanent LeadershipKP Minister Announces Rs.1.5Billion For Science Agenda ProgrammePakistan Aimed To Gain Numerous Benefits From Japan’s Expertise In TechnologyScientists use microscopic robots to carry drugs to the brain for the treatment of tumorsScientists aim to safeguard the DNA of all Earth life on the moon as a backupChinese scientists develop possible anti-ageing therapyGoogle adds AR science lesson features to SearchChinese database drops paywall to help fight coronavirusChina honored Dr. Atta-ur-Rehman with the highest scientific AwardScientists Measure “Quantum Distance” in Solid Material: A First for PhysicsEnergy StorageScientific DevelopmentsSupercapacitorsVitamin A & E Supplements: Are They Doing More Harm Than Good?Thanks to Science, Your Body Organs May Self-Repair SoonSehat Kahani telemedicine platform connects Critical Care Specialists to ICUs across PakistanPakistani healthtech startup MedznMore raises $2.6 million in seed fundingNew Brain-Computer Interface Can Now Read Your Thoughts!Pakistan Wins Gold at International Science Olympiad in Historic FirstScientists Capture Single Atoms with New Optical Microscope In A Historic FirstPakistan Develops First Indigenous Anti-Rabies VaccineIndia & Australia Unite for Undersea Surveillance ResearchDRAPPIMSSZABMUInternational Lunar Research StationSpace TechnologyTrainingOmoda E5 EV SUV Officially Launched in Pakistan with Advanced FeaturesIs the Kia EV9 Headed to Pakistan? Lucky Motors Drops a TeaserThe New Toyota C-HR Hybrid And Electric Both:A Bolder VisionSony Teams up with Honda to make Premium Electric Cars by 2025Honda Unveils its First All-Electric SUV: The PrologueHuawei reveals the world’s first digital car key based on Bluetooth and NFCToyota set to globally debut its first all-electric SUV in 2022Huawei and DFSK’s Premium Hybrid SUV is coming to PakistanToyota’s First Electric Vehicle Will Hit The Road In 2022Honda unveils its new electric SUV as a conceptopenRickshaw87 New Electric Buses Arrive in RawalpindiGovt Eyes November for Rawalpindi Electric Buses LaunchBitcoin Drops Sharply as Global Risk-Off Sentiment SurgesBitcoin Poised for Rebound With Leverage Purge, Macro Pivot & Renewed Investor ConfidenceBitcoin Below $90K: Market Turns Risk-Off and Institutional Selling IntensifiesAnalyst Assigns 55% Chance That Bitcoin Bull Run Isn’t Over Yet: Here’s WhyBYDcharging stationsslipping below $110,000Federal governmentIndustrySMEsPakistani Rupee Gains Slightly Against US Dollar in Intra-Day TradingMashreq Bank Unveils Pakistan’s First Current Account With up to 5% ProfitDubai’s Mashreq Launches Pakistan’s First Islamic-Focused Digital BankADB Approves $330 Million Loan to Strengthen Pakistan’s Power GridPakistan Stock Market (PSX)Why Ethereum Might Be the “Digital Gold” Which Outshines BitcoinMove Over Silver! Bitcoin is Now the 6th Largest Asset in the WorldBitcoin Could Drop to $92K as Demand Weakens: CryptoQuantBitcoin Hits Latest All-Time High as Market Sentiment GrowsBitcoin price eyes $110K as US-China trade deal LoomsBitcoin Nears $90,000 as ETFs Lose Momentum After Five-Day SurgeBitcoin Approaches $90,000 Mark After Another Record High SurgeBitcoin Hits $80,000 Milestone for the First TimeCrypto market worth $2 trillion, Bitcoin stands at $1.1 trillionThis video game lets you ride Bitcoin price chartsMaster Changan Unveils 3 Brands & 11 New Models at PAPS 2025Government Starts PAVE Scheme to Provide Subsidized EVs Across PakistanAtlas Honda Addresses Market Rumors on Electric Bike LaunchPunjab Introduces E-Taxis to Address Air Pollution and UnemploymentGovernment Unveils Policy to Shift 30% of Vehicles to Electric by 2030Indus Motor Company Promises To Launch Corolla Cross Hybrid CarToyota Corolla Cross Hybrid: Spotted In KarachiXiaomi Won The Approval To Manufacture Electric VehiclesToyota Unveils Groundbreaking Electric Vehicle Battery:10 Minute Charging Time And 900 Mile RangeAt Auto Shanghai 2023, Honda Unveils Three Electric VehiclesXiaomi Plans To Begin Mass Production Of Electric VehiclesRawalpindiFBR to Launch Online Auction for Seized VehiclesPakistan to Establish Social Media Regulatory AuthorityPakistan, Hong Kong Sign MoC to Modernize Justice SystemPakistan Sets Up Digital Authority Under Landmark Law, Announces Key AppointmentsSupreme Court Ushers Digital Justice Era with New 2025 RulesICE1,100 vehiclesloansSindh Rolls Out Pink EV Scooters for Women and 2.1 Million Free HousesLahore’s Emission Testing Plan Faces Criticism for Excluding Major PollutersBYD Sued For Human Trafficking By BrazilXiaomi Launches Tesla rival Model with Stunning New FeaturesHyundai And Kia Collabrate To Introduce EV Charging Robots In KoreaGovt Approves EV Production Licenses for 57 CompaniesPakistan Rolls Out First Locally Assembled Seres 3 EVGoogle Maps Stops Showing Gas Stations to Electric Vehicle OwnersUsed Electric Car Prices Are Falling Faster:Why?Tesla Launches Solar Charging Feature to Lower Electricity Billsmanufacturedpic.twitter.com/12jPIIlsflAugust 6, 2025fareLahore electric tramSuper Autonomous Rapid Transit (SART) systemBitcoin Hovers Around $100K as Analysts Signal ‘Bottoming Phase’first batchsaidElectric bus fareGold and Silver Prices in Pakistan Today, 2nd December, 2025Pakistani Researcher’s Team Wins Prestigious Supercomputing ‘Nobel’Pakistan set to utilize Chinese technology to boost organic peach growing in the countryPakistan needs to adopt modern farming tech to save water & money, ICARDAElectric TrucksEV Charging HubMaryam Nawaz Unveils Rs100bn Aid for Punjab Flood VictimsPunjab School Closures Over Floods Affect 680,000 StudentsFloods Force School Closures in Punjab as Govt Extends VacationsPTA Flood Relief Measures Announced for Punjab ResidentsPunjab Floods Force NADRA to Temporarily Shut Service CentersSialkot Airport Flights Suspended as Flooding Crisis Hits PunjabPunjab May Extend School Holidays in Flood-Affected AreasLucid AirNexGen AutoNishat PowerPakistan electric vehiclePakistan EV Policy Allocates Rs9 Billion for Green MobilityIndia Gets Suzuki Electric Alto — Is Pakistan Next in Line?# Public transportYoung innovator from Layyah invents an electric mini tractorTrailer carrying Korean electric cars overturns in NawabshahFord doubles its investment in electric and autonomous vehicles to $29bnApple to invest $3.6b in Kia Motors to develop the Apple CarTesla unveils new Model S with a new interior design, half a steering wheel, and a complete gaming experienceGovernment to establish an Electric Vehicle board to promote commercialisation of electric carsHamnah KhalidMicrosoft teams up with General Motors for self-driving carsFor the first time ever, factory produces electric car battery capable of charging in five minsHundreds of EVs stuck at ports as importers wait for govt ordinance to avail tax exemptionsGovernment is responsible for at least 50% increase in car prices over the past 2 yearsUS investors interested in assembling electric vehicles in PakistanSigma Motors launches Pakistan’s first hybrid solar, electric, and fuel carXiaomi to manufacture EVs using another company’s plantDaymak claiming to make the world’s fastest three-wheeled Electric VehicleElon Musk says people can now buy a Tesla vehicle using bitcoinTesla cars have been banned from China’s military complexes for security reasonsgrowingNishat Groupofficial Islamabad Police websiteIslamabad PoliceChinese Luxury EV Zeekr 009 Set to Enter Pakistan’s Auto MarketRiddara RD6 Electric Truck Price Officially RevealedFBR Announces NEV Adoption Levy on ICE Vehicles: Details InsideA Preview of Xiaomi YU9 SUV: Bold Entry Into Full-Size EVsChery’s Electric and Plug-in Hybrid SUVs Reportedly Coming to PakistanReasons Behind Tesla Success in An Automobile Industrypak china friendshipNew Energy Vehicle (NEV) Policy 2025-2030green energyNEV PolicySamsung-Google Jointly Reveal World’s First Android XR HeadsetGovt, Military Institutions on High Alert After Critical Oracle Security Flaw Exposes Systems to Cyber AttacksPakistan Forms 9 Computer Emergency Response Teams to Strengthen CybersecurityPakistan to Re-Enter Global Debt Markets with New Eurobond IssuanceGovt Eyes $50 Billion Target to Increase Remittances to PakistanPakistan, ADB Partner on Rs14 Billion Women Loan FacilityNew Taxes on Mutual Funds and Poultry Announced in the Mini Budget 2025-26Pakistan Minimum Wage 2025-26: Govt Ignores Inflation, Keeps Rates UnchangedFinance Minister Leads Strategy Meeting on Pakistan Digital EconomyBudget to Feature Tax Relief, Bold Reforms: Finance MinisterExport-Led Growth in Pakistan Vital for Economic Stability, Says Finance MinisterPakistan Asks China To Roll Over Debtsuccessful trialsElectric Tramseparate lawsuitTesla Model SQualcomm Unveils Snapdragon 8 Gen 5 to Challenge High-End Chips on ValueSnapdragon Phones to Gain Android to iPhone File Transfer via Quick ShareMeta Acquires Rivos as Part of Ambitious AI Chip and Hardware PushGoogle Plans to Bring Android to PCs, Qualcomm CEO Says He’s Already Seen ItMediaTek Dimensity 9500 Launches With Faster AI and Gaming UpgradesQualcomm Unveils Dragonwing Q-6690 Enterprise Chipset, Featuring RFIDQualcomm’s Snapdragon W5 Gen 2 Chips Bring Amazing Tools to UsersQualcomm Wants Android Users to Update, Says Fixed 3 Chip BugsApple’s 2025 iPhone SE Gets Powerful In-House 5G Modem : Here’s Why It MattersEurobondpakistan debtTPL Trakker Reports 43% Drop in Annual TurnoverPakistan Tobacco Company Profit Rises 23% in 9MFY25Bank Al Habib Profitability Sees Decline in First Half of 2025Meezan Bank Profitability Drops 10% in H1 2025 ReportAl-Ghazi Tractors Swings to Rs75m Loss in H1 2025Askari Bank Profit Up 32% YoY in 1HCY25Mari Petroleum Earnings Drop 16% in FY25Fauji Cement Posts Record Rs13.3bn Profit in FY25Emirates becomes the most profitable Airline globallyFoodpanda Pakistan’s €11.2 Million Profit: Milestone or Mirage?first electric tramCDA ISBCDA Islamabad ProjectsIslamabad electric tramsstrategic share buybackPhilip Morris PakistanStocksBritish American Tobaccosystems limitedGovt Plans Interest-Free Loans for Punjab E-Taxi SchemeDFSK Volt EV Installment Plan – Own Electric Car in 36 MonthsBalance SheetCashflowsDenimKia Pakistan Set to Launch its First Electric Vehicle at PAPS; Sparking EV RevolutionMIT Grad Swaps Lasers For Cameras, Enhances Car VisionElectric Scooter Launched In UAE: Made In IndiaNew Electric Bike And 3 Wheel Makers Are Bringing Two-Three Electric Wheel Bike In PakistanTesla’s New Invention:Cybertruck Cat Tray That Your Pet Can Use To Poop And SleepPace Pakistan Finalizes Sale of Stake in Pace Super Mall# NEPRAPakistan’s Remittances Rise 11.3pc YoY in SeptemberState Bank Keeps Interest Rate UnchangedK-Electric, NEPRA Clash Over Tariff Cut and Financial Impact: What is it All About?PAF to Take Over PIA Subsidiary Under Restructuring PlanPower Division Slashes Smart Meters Prices to Speed Up National DeploymentGovt’s New Solar Net Metering Policy Could Eat Into Your Electricity SavingsFitch-Rated Sukuk Market Jumps to $231 Billion in 3Q2025Cement Sector Earnings Jump 55pc in 1QFY26Electricity BillsNEPRASamsung to Reveal Project Moohan XR Headset at October Galaxy EventFederal Government Rental Ceiling Raised by 85pc for EmployeesAGP Flags Major Irregularities in NBP Stake Sale to Bestway GroupPakistan and Canada Finalize Canola Export PlanPakistan, Germany Seal €114m Development DealPunjab Govt Ends Pension for Future EmployeesDISCOs Push for Fixed Charges on Solar Net Metering UsersApple AirpodsAlibaba Just Changed the Wearable Game With Its Qwen-Powered AI GlassesMeta’s Hyperscape Lets You Share Your Real-World Room as a VR HangoutHyundai Car Price Hike in Pakistan: New Rates Post Budget 2025-26Govt Exempts Income Tax on Rs1.2 Million Annual SalaryGovt Withdraws Sales Tax Exemption on Imported Cotton YarnGovt Eases Eligibility For Undeclared Asset Holders On Buying Cars & PropertyFBR Exempts One-Time Online Sellers from RegistrationPetroleum Levy in Pakistan Set to Rise Under IMF CommitmentsSpecial Relief Package Confirmed for Armed Forces in the BudgetTax Relief on Old Car Imports Proposed in Budget Plan Sent to IMFMovie Tickets to Get Expensive as Govt Withdraws Cinema Tax ExemptionPM Shehbaz Approves Raw Material Duty Cut for Industrial GrowthPakistan Defence Budget May Get a Whopping 114% Rise This YearPBC Budget Proposals Urge GST Cuts and Relief for Salaried ClassTether Collaborates with US Lawmakers on Stablecoin Regulations: ReportPSX Surges 1.5% on Banking Sector Strength, Easing Border TensionsDemocratsNew YorkArms License Renewal Now Possible Through NADRA Mobile AppNADRA Introduces Online Appointment Booking via Pak ID Mobile AppNADRA Confirms Offices Closure Timings on Sept 6 HolidayreportXRP Targets $3 as Whale Wallet Count Hits Record HighsXRP Surges Above $3, Targets 40% Gains in October 2025Bitcoin Hits $114K, Traders Eye $110K Dip Market UpdateGul Ahmedtextile industryAnonymous formPodcastMastodonNotificationsRSSNewsletterFront PageRoundups Show RoundupsAirPods 4AirPods MaxApple Black FridayApple DealsApple PayApple Pro Display XDRApple Studio DisplayApple Watch 11Apple Watch SE 3Apple Watch Ultra 3CarPlayHomePodHomePod miniiMaciPad AiriPad miniiPad ProiPadOS 26iPhone 16iPhone 18Mac miniMac ProMac StudiomacOS Tahoe 26watchOS 26How TosReviewsBuyer's GuideForumsVisit ForumsAll >RoundupsUpcoming ProductsArchivesJuli CloveriPad mini 7Apple Intelligenceleaked in an unboxing videoM2might introducethe next Vision Proseveral other devicesupdated S-series chipAirTagfrom further distancesMark Gurmanlate 2025 and early 2026M191 commentsiPhone Pocket is Now Completely Sold Out WorldwideJoe RossignolRead Full Article138 commentsApple and Intel Rumored to Partner on Mac Chips Again in a New Way113 commentsThe Best Black Friday iPhone Deals Still AvailableMitchel Broussard3 commentsHere's Why the Apple Store is Going Down18 commentsBest Black Friday Streaming Deals - Save Big on Apple TV, Disney+, Hulu, and More22 commentsiPhone Air Flop Sparks Industry Retreat From Ultra-Thin PhonesTim Hardwick243 commentsThe MacRumors Show: Apple's Big Plans for iPad Mini 8Hartley Charlton25 commentsFoldable iPhone to Debut These Three Breakthrough Features130 commentsapparatchikLikeDisagreeppdixnewyorksoleSegNerdkiranmk2dumastudettoRead All CommentsApple's M4 MacBook Air Drops to $738.04 Low Price for Cyber MondayiOS 26 FeaturesiOS 26.1 Features50 macOS Tahoe FeaturesiPhone 17 vs iPhone 17 Pro vs iPhone AirApple Intelligence GuideImage Playground GuideiPhone Mirroring Not Working?iPhone 16 and iPhone 16 Pro: How to Use All the New FeatureswatchOS 11: All the New Features and ChangesWhat's New in iOS 18 MessagesiOS 18 Photos ChangesNew AirPods Features in iOS 1821 Time-Saving iPhone Tips14 macOS Tips to Make Your Life EasierOne AirPod Not Working?See more guidesStudio DisplayLow-Cost MacBookSee full product calendarApple Watch Ultra 3 Hits New Record Low Price of $679 ($120 Off) [Update: Sold Out]OLED iPad Mini: Release Date, Pricing, and What to ExpectHere's What Apple is Offering for 2025 Black FridayTwitter Down on iPhone and Web: Posts on X Aren't Loading Right NowApple's Base iPhone Model Is Taking a Gap YearAbout MacRumors.comAdvertise on MacRumorsArnold KimEric SlivkaMarianne SchultzDan BarberaRyan BarrieauSteve MoserAaron PerrisDo NOT Buy an Apple Product Until You Watch This — Black Friday 2025 GuideBest Holiday Tech Deals - Cyber Monday 2025This M5 MacBook Pro Desk Setup Is PerfectApple Finally FIXED iPad Multitasking in iPadOS 26.2Is Tim Cook about to retire?? #apple #timcook #ceoThe MacRumors ShowApple’s Big Plans for iPad Mini | Episode 174iPhone 18 Pro Looks Like a Huge Upgrade | Episode 173iPhone Pocket Launches and iPhone Air 2 Delayed | Episode 172AirPods Pro 3 and What's Coming Next | Episode 171Giving Apple Vision Pro Another Chance | Episode 170Privacy / DMCA contact / Affiliate and FTC DisclosureAccessibility StatementFeatured On/OffFull Articles On/OffFluidFluid HDLightDarkWomen’s Active Bank Accounts in Pakistan Rise to 37 MillionGold Prices Flat in Pakistan as Global Market Sees Minor DeclineRs53 Billion Refund for Electricity Consumers on the CardsPakistan-Kyrgyzstan Trade Aims for $100 Million RevivalFBR Customs Values on Duplex and Packaging Board RevisedSBP Unveils New Framework to Ease Bank Account OpeningPakistan’s Pharmaceutical Exports Highest in 20 YearsGovt Sets New Date for Utility Stores ClosureUBL Workday Now Includes Sunday to Serve Customers DailyPSEB Audit Report Uncovers Major Financial IrregularitiesPM Directs Launch of Digital Invoicing System in UrduZTBL Refutes Media Reports on Alleged Rs. 11 Billion Loan LossesSBP to Roll Out Pilot for Pak’s Own Digital CurrencyMoney Link Exchange Ceases Operations in PakistanMeta Q2 2025 Earnings Beat Expectations with AI-Driven Ad GrowthMicrosoft Market Cap Hits $4 Trillion After Strong Q4 EarningsApple’s Display Upgrade: OLED Screens for Upcoming iPads and MacBooksiOS 26.1 Beta Brings Option to Dull the Liquid Glass AestheticGovt Appoints Faisal Iqbal Ratyal as New NITB CEOKarachi Green Line Project Nears Completion, Govt Confirms Official Launch DateOnePlus 15 Spotted on Geekbench With Powerful Battery and Performance NumbersOppo Pad 5 Brings Flagship Performance, Watch S Adds Smart Fitness FeaturesNADRA Revises Centre Timings for Winter 2025 in Khyber PakhtunkhwaNADRA Issues Warning on Fraudulent NICOP Website Targeting ExpatsNADRA Brings Online Biometric Verification for Islamabad VehiclesNADRA Urges Citizens to Collect CNICs Promptly to Avoid Disposal DelaysPunjab Assembly Proposes Adding Blood Group to CNIC for Public SafetyNADRA Launches Mobile Registration Drive for Overseas Pakistanis in the UKNADRA Opens Applications for 200 New JobsNADRA Makes NICOP Cancellation Free for Overseas PakistanisMacbook M5OLEDPower On newsletteriPadsSamsung to Launch Tri-Fold Smartphone in December With Limited ProductionGovernment Strengthens Personal Data Protection and Cloud Governance Across Public SectorPTA Declines VPN Ban, Prioritizes Pakistan’s IT GrowthChatGPT Conversations Not Protected: OpenAI CEO Raises Privacy ConcernsAI Privacy Risks You Can’t Ignore: The Hidden Cost of Smart ToolsNew SSD Self-Destructs On The Press of A Button To Protect InfoDeleted ChatGPT Conversations Might Not Be Gone Forever—Thanks to This Court RulingFastmail Gains Momentum as Gmail Users Seek Better PrivacyPakistan Consumes Up to 90,000 Kgs of Gold Annually, Says CCP StudyCompetition Commission of Pakistan Approves PEL’s Acquisition of Stakes in PKP Group CompaniesCCP Releases Competition Analysis Report, Highlighting LNG Market ChallengesApple M5 Officially Introduced with Next-Level AI PerformanceApple Doubles Down on Immersive Films for Vision ProApple iPadOS 19 Set to Redefine Productivity with Mac-Like Features and Multitasking Powerreports from ChinaXiaomi’s flagship lineup14 Medical and Dental Colleges Face PM&DC ActionPM&DC Orders Pre-Hoc Paper Review for MDCAT 2025PM&DC Financial Blunder of Rs200m Under Review for RecoveryPM&DC Licensing System Debuts in Lahore for Medical RegistrationsPM&DC Reduces MBBS and BDS Merit Criteria by 5% for 2024-25PM&DC Moves to Standardize Private Medical and Dental College Fees in PakistanGovt to Cancel Registration of Medical and Dental Colleges Failing to Refund Excess FeesNADRA to Launch Self-Service Kiosks for CNIC Renewal NationwideNADRA Launches Digital Birth and Death Notification System Across Pakistan7 Million Pakistanis Without CNICs, NADRA Issues Fraud AlertNADRA Mobile Registration Drive Coming to UK on THIS DateNADRA Mobile App Lets You Cancel Your Own ID After Death — But How?NADRA Karachi Service Center Now Open to PublicNADRA Karachi Center Closed for Two WeeksNADRA launches Amnesty Scheme to fix CNIC errors without penaltyMobile and data servicesSchoolsPTA-announced temporary disruptionmotorwayMaryam NawazBusesMinisterApple WWDCVision Pro 2Apple TV Will Stream Major Football League Matches for Free Starting in 2026Apple TV and Peacock Join Forces in New $14.99 Monthly Streaming DealApple Expands Apple TV App to Android Smartphones and TabletsPunjab ExamsPunjab UniversityPakistan’s Trade Deficit Widens 39% to $12.7bn in July–October as Exports Fall, Imports SurgePakistan’s Trade Deficit Jumps 34% in Latest QuarterPakistan’s Trade Deficit Soars 46% in September 2025Pakistan’s Imports Rise by $1 Billion in July 2025Pakistan Trade Deficit Widens to $2.75 Billion in July 2025Pakistan’s Services Exports Rise by 6.16% Despite Growing Trade DeficitX Fold 5X200 ProX200 FEV60 (512GB)V50 Lite 5GV50 LiteY400Y29 (128GB)Y19s ProY19sY04 (128GB)AIOU to Launch 3-Month Russian Language CoursePunjab to Launch First-Ever University Ranking SystemGovt Reappoints Dr. Raheel Qamar as COMSATS RectorAdmissions Crisis Hits University of Peshawar Amid Fee HikeWorld Bank Reviews $400 Million HEDP Project with HEC PakistanPunjab Extends Honhaar Scholarship Deadline to Oct 26Switzerland Scholarships 2026–27 for Pakistani StudentsSenate Reviews COMSATS Quetta Campus Delay, Urges ActionHEC Releases Updated Curricula for Sociology Degree ProgramsWorld Bank Reviews Progress of $400M Higher Education Project in Pakistan7,300 Teaching Interns Hired Across PunjabRawalpindi Electric Bus Service Launch Set for Next WeekPeople’s Bus Service Extended to Three More Sindh DistrictsIslamabad Announces New Metro & Electric Bus Ticket RatesCCP’s conditional approvalAmazon Invests $100 Million Towards a Generative AI CenterAmazon Has Been Working on a Technology Similar to Chat GPT Since a Long TimeAmazon Has Lost A Record $1Trillion In Market ValueAmazon- Jeff Bezos Made This Company A SuccessJeff Bezos is all set to blast off into spacePeople Are Now Signing A Petition To Prevent Jeff Bezos From Returning to EarthJeff Bezos Set To Fly To Space Next MonthMusk pokes fun at Bezos in battle over space contractWho will be the world’s first-ever trillionaire? The race has begun & the candidates are all American!BREAKING – Jeff Bezos to step down as Amazon’s CEOElon Musk’s story is one for the history books of how he became the richest man in the worldTalha IkramJeff Bezos’ company may charge $200,000 for each space tripShehryar AhmedPMDC New Policy Leaves Foreign Medical Graduates in ConfusionHealth Ministry Resolves MDCAT Out-of-Syllabus IssueMDCAT 2025 Test Centers Announced Across PakistanPakistan’s Telecom Revenues Collapse Despite Record Data UsagePM Shehbaz Launches Pakistan’s First National Semiconductor Initiative “INSPIRE”Islamabad IT Park to Launch on August 14Pakistan Telecommunication Authority (PTA) suspended mobile internet servicesInternet Disruptionmobile internetPSX to Maintain Upward Trend Amid IMF Review and Investor OptimismProvinces Get 24 Hours to Meet IMF Fiscal TargetsIMF Seeks Briefing on $7.7bn Reko Diq Mining ProjectMicrosoft Bing Chat Will Now Allow You to Search With ImagesOpenAI Brings ‘Bing Search’ To ChatGPT:To Get The Latest InformationEmployees Secretly Using ChatGPT-AI: Threat For Tech LeadersOpenAI Is Ready To Pay You $20,000:If You Find Bugs In It’s AI Chatbot9 Amazing Things Bing With ChatGPT Can Do For YouA Wharton Professor Gave AI Tools 30 Minutes To Work On A Bussiness ProjectMicrosoft Warns To Cut-Off Rival AI Chatbots From Bing DataGPT-4 Can’t Stop Helping Hackers Build Cybercriminal ToolsBing Said To Remove Waitlist For It’s GPT-4 Powered ChatChatGPT can Take Your Career To The Next Level:Check How?ChatGPT-4 Language Model Can Handle Text And ImagesBrave Browser Adds AI Capabilities to its Search EnginePunjab to Launch New Cybercrime Wing: Dissatisfaction with NCCIAPunjab Government to Distribute 10,000 Free Electric Bikes to StudentsPunjab Launches Cyber Patrolling Unit to Tackle Online Harassment Against WomenLahore to Get Pakistan’s First AI UniversityPunjab to Deploy 1,500 Electric Buses Across the Province Under New Green Transport PlanPunjab CM Laptop Scheme 2025 Closes Grievance Process with Students Awaiting Merit List and Laptop DistributionMan Arrested for Spreading Fake Video Targeting Punjab CM Maryam NawazPublic Funds or Personal Promotion? Petition Challenges Punjab CM’s Ads on Publicly Funded Electric BusesOnline Registration for CM Punjab Laptop Scheme 2025 Now Open: Here’s How You Can Apply?Vivo Launches V60 Lite in Pakistan with AI Portrait PowerGoogle’s AI Coding Tool Hacked Just One Day After LaunchMicrosoft Users Threatened by The New “rnicrosoft” Phishing ScamMeezan Bank Customers Targeted via Spoofed Official NumbersTikTok Users Can Now Share Tracks from Amazon MusicAmazon and Microsoft Join Push to Curtail NVIDIA’s China Chips ExportsAmazon Fire Tablets to Run on Android Instead of Fire OSAmazon Acquires Bee to Power Next-Gen AI WearablesAnother White House Official Hacked (Again)Trump Explores the Idea of an ‘AI Czar’ PositionBritain to Host World’s First Global Summit on Artificial Intelligence SafetyPTCL Stock Poised for 58% Surge Following Telenor MergerPTCL Races to Acquire Telenor Ahead of 5G Spectrum AuctionPakistan’s First 5G Auction Nears Crucial Decision as Litigation and High Costs Threaten RolloutCCP Grants Conditional Approval for $400M PTCL–Telenor Pakistan MergerFrom Spectrum Shortage to 5G: Pakistan’s Telecom Sector at a CrossroadsCCP Recovers Rs10 Million Penalty from PIA for Hajj Fare Hike Abuse‘Pak Hajj’ Mobile App Launched to Assist PilgrimsZong 4G Launches IDD Mobily Bundles For Saudi Arabia During HajjThis app lets you stay connected with your loved-ones during Hajj with real-time location sharing featureSaudi govt announces free SIM and internet facilities for Hajj PilgrimsLabbaik VR will be your virtual guide for Hajj and exploring the Holy Ka’abaPakistan gets an electronic system & app to resolve complaints of Hajj pilgrimsGovernment of Pakistan to use digital lockets or bracelets for monitoring Hajj pilgrimsThis startup Book My Umrah lets you find the best value package for your Hajj & ZiyaratSpotify’s Next Price Jump Will Hit US Users in Early 2026Spotify Now Supports Transferring Playlists From Other Music AppsSpotify Users Await Wrapped 2025: What to Know and When It’s Likely to DropSpotify Now Lets iOS Users Try AI Audiobook RecapsSpotify Tests ‘SongDNA’ to Spotlight Music Creators Behind Every TrackSpotify Announces New Policies to Address AI-Generated Music On the PlatformWhat is a deepfake and how it is creating AI-powered fake media?TechJuice interviews Issay Yoshida – founder, xpression camera – the live appearance altering appConcerns arise about WOMBO.AI – the “deepfake” singing appSeeing is no longer believing. Viral Tom Cruise deepfakes mark the beginning of the era of Deepfakes raising widespread global alarmHarvard professor launches startup to help companies protect their AI systems from hackersResearchers are now using heartbeat detection to accurately identify deepfakesPunjab Govt to Revise 11th Class Syllabus After ComplaintsPunjab May Implement Winter Timings in Schools from TomorrowPunjab Issues New Update on School Operations for October 13Punjab Govt Recognizes BS Degrees for Teacher PromotionsAudit Exposes Massive Solar Panel Theft in Punjab SchoolsPunjab Online Textbooks Now Downloadable for FreeGovt Sets New School Timings in Punjabeasypaisa Digital Bank Posts Rs. 5.6 Billion Profit in First 9 MonthsRDA Inflows Rise 20% to $196 Million in September 2025SBP Launches Zarkhez-e Digital Platform for Small FarmersDigital Banking Users in Pakistan Surge Past 96 MillionSECP Pushes Sukuk Expansion, Digital Reforms to Boost Financial InclusionEasypaisa Digital Bank Reports 39.4% Profit Growth in H1 2025Strict Virtual Asset Regulations 2025 Finalised by PakistanZong Tops PTA Complaint Chart for July 2025 with 2,898 CasesPakistan Sees Significant Growth in Mobile Internet and Social Media Usage, PTA ReportsT-Mobile Expands T-Satellite Coverage to All CustomersT-Mobile to launch Starlink-Powered satellite messaging soonHow to Enable & Disable Starlink on Your iPhoneT-Mobile’s Starlink Beta Now Open to AT&T and Verizon CustomersPakistani Meme Goes Viral After Elon Musk Responds to Trump–Mamdani JokeChina Accuses US of Cyberattack on National Time CentreAnti-Smog Guns Spark Water Scarcity Concerns in LahoreLahore Air Quality Remains Worst Globally as AQI Stays HazardousLahore Now the Second Most Polluted City GloballyPunjab Cracks Down on Smoke-Emitting Vehicles to Fight SmogQingqi Rickshaw Manufacturers Face License Ban, Sealing ThreatWorld Bank Approves $300 Million Loan for Punjab Clean Air Program to Tackle SmogLahore High Court Orders Installation of EV Charging Stations to Combat SmogFailed Smog Tower Highlights Need for Comprehensive Air Quality Policies in LahoreCybersecurity Threatindia attacks pakAirlineAustraliaData BreachOpenAI Launches o3-pro: Its Smartest AI YetOpenAI’s Sora Video Generation Model Now Available in the EU and UKOpenAI Rolls Out Operator to Global Markets, Excluding the EUChatGPT Plus and Pro: Are They Really Worth the Cost Compared to Free?OpenAI’s Sora Can Turn Text into Video: Here’s What You Need to KnowOpenAI Rolls Out $200 ChatGPT Plan Exclusively for Research PurposesAI musicPunjab Moves to Privatize 4,500 More Schools as Teachers Warn of Sector-Wide DisruptionPunjab Enforces Province-Wide Ban on Mobile Phones in SchoolsPunjab Schools Get Tough Security Measures Amid Rising ThreatsPunjab Proposes New Screening System for School StaffPunjab Orders Stricter Security Measures in All SchoolsPunjab Postpones First-Term Exams Due to FloodsPunjab Revises Textbooks for Middle and High School StudentsPunjab to Recruit 12,000 School TeachersPakistan Vows To Fast-Track Digital Asset Rules as Binance CEO Arrives for High-Level TalksCloudflare Down: Major Outage Disrupts X, Canva, and SubstackApple Announces 2025 App Store Awards Winners Across Apps and GamesPTA Clears Major Telecom Acquisition, Paving Way for 5G AuctionUSD to PKR Today: Dollar Rate Holds Steady at 280.25 in PakistanNCCIA Head to Face Senate Over Corruption Claims; ICT Commissioner Summoned for Data Protection BriefingBitcoin Falls to $91K as ETF Outflows Hit Crypto SentimentHigh Demand Prompts Alektra to Extend Metro 4-Door EV Discount in PakistanPunjab’s Premium Number Plate E-Auction for December Is Live NowWorld’s First Robotic-Assisted Cataract Surgeries Performed with High PrecisionMaster Chery Launches Priority Pre-Booking for Its New Super PHEV SUVs in PakistanPakistan to Launch AI App to Curb Illegal Travel and Visa FraudIntellexa Leaks: Pakistan Denies Use of Israeli ‘Predator’ SpywareKaspersky Reports Detecting 500,000 Malicious Files Daily in 2025Federal Government Establishes Pakistan Digital Authority, Appoints ChairpersonPakistan Cybercrime Complaints Surge Past 142,272 in 2025 as NCCIA Launches Major Nationwide ExpansionFauji Fertilizer Secures “Best Corporate Excellence Award” at MAP AwardsService Long March Tyres to List on Pakistan Stock ExchangePakistan’s FX Reserves Rise by $14 Million as SBP Holdings Reach $14.57 BillionSamsung Confirms Exynos 2600 With First Official TeaserMotorola Edge 70 Ultra Leak Reveals Key SpecsOnePlus 11 Begins Receiving OxygenOS 16 Update with Android 16Vivo Reportedly Building X300s for 2026, Featuring a Big Battery UpgradeSamsung Galaxy Z TriFold Arrives This Month with $2,450 Price TagPTA Imposes Stringent Safeguards as PTCL Gets Conditional Approval to Acquire Telenor PakistanPTA Grants Conditional Nod as PTCL Accepts Terms for Telenor Pakistan AcquisitionUniversal Service Fund Approves Rs. 13B Projects to Bring High-Speed InternetMeta Rolls Out AI-Powered Account Support for Facebook and Instagram UsersSpotify Releases 2025 Wrapped as Talha Anjum Tops Pakistani Charts for Second Consecutive YearSpotify Wrapped 2025: What’s New With Your Favorite Music Recap of the Year?YouTube Finally Adds a Yearly Recap to Highlight Your Watch HabitsPolice Give Students One Week to Get Motorcycle Licenses Under New Traffic PolicyMG U9 Price in Pakistan Announced: Booking, Variants, Specs & Delivery UpdateHEC to Launch Blockchain Based Degree Attestation System Within Six MonthsUK Universities Declare ‘High-Risk’: Admissions Closed for Pakistani, Bangladeshi ApplicantsPunjab Schools Winter Vacations Announced & Board Exams PostponedAalto University Finland Scholarship 2026 Opens for Master’s StudentsBank of Punjab Launches Campaign for Students Under Interest-Free Bike SchemeGoogle Year in Search 2025: Gemini & AI Dominate Global TrendsChatGPT May Soon Show Ads as OpenAI Tests New Monetization ModelDeepSeek v3.2 Launch Signals AI Agent Arms Race at Human-Level AmbitionsDeepfakes, Biases & A Looming Media Crisis: Tech Experts Highlight AI Concerns at SOT XIXCNFLahoreFIA Uncovers Rs120m Islamabad Illegal Call Centre Scandal Involving NCCIA OfficersTransparency International Pakistan’s 2025 Corruption Findings Expose Critical Trends Across PakistanUK Cancels Visa of Pakistani Social Media Influencer Rajab ButtDate Confirmed For Islamabad’s First Ever Car Free Pedestrian Food StreetRs. 210 Million Worth of Smuggled Luxury Vehicles Seized in Quetta OperationPTCL SMS on Meta Maintenance Fuels Questions After Reported Service SlowdownsUfone Partners with MyCO for Exclusive Streaming Deals: Watch EPL for Just Rs. 100Pakistani Startup SAHL Wins $30,000 at Black Hat MEAFacebook Unveils Major Instagram-Style Redesign With New Photo Grid FeedGold and Silver Prices in Pakistan Today, 10th December, 2025Bitcoin Near $91K as 2025 Target Slashed to $100,000Women Led Pakistani Startup Raises $800,000 Pre-Seed to Transform Pakistan Wedding IndustryOnePlus 15R to Ship With Record 7,400 mAh Battery Outside ChinaNA Committee Pushes FBR to Reduce Heavy Smartphone Taxes in PakistanRealme Narzo 90 Rumored Specs and Color Options LeakedNewly Launched US EDUCATIONAL Foundation in Pakistan Building Envisioned as a Center for Pakistan’s Future ScholarsExpress NewsAir PunjabCCAPremium Textile Mills to Set Up International Presence with UAE SubsidiaryOkara Launches Beta Private AI Platform with 20+ Open-Source ModelsPTA Unveils 15-Year VPN License Framework & USF Targets Highway Internet Black Spotsfull list hereMEXT ScholarshipGoogle FormGSFS formGraduate School of Frontier Sciences (GSFS)Department of Natural Environmental StudiesDepartment of Ocean Technology, Policy, and EnvironmentDepartment of Environment SystemsDepartment of Human and Engineered Environmental StudiesDepartment of Socio-Cultural Environmental StudiesDepartment of International StudiesGraduate Program in Sustainability Science (GPSS)scholarships for pakistani studentsUK Visa Scandal Uncovered: Thousands Passed IELTS Test Through CheatingU.S. & Pakistan Unveil State-of-the-Art USEFP Educational HubPunjab Refuses to Increase Overseas Pakistanis’ Quota in Medical CollegesPunjab Makes Strict Security SOPs Mandatory for All Schoolsreports,Galaxy Z Fold 7,Samsung foldable phoneXiaomi 17 Expected to Go Global in January, Leak ClaimsIntel Could Join Apple’s Chip Supply Chain for iPhones and MacsRed Magicsource,NubiaiPhone 16 Crowned Best-Selling Smartphone Globally in Q3 20255G Auction Announced in 2 Months: Minister Defends Mobile RatesPakistan’s Trade With Central Asia Drops Despite Transit AgreementsSindh to Expand Karachi’s E-Challan System to More Districts5 Games You Can’t Afford to Sleep On: The Definitive Best of 2025MoITT Admit Helplessness Over Internet Blackouts: Hands Are TiedNepra Fines National Grid Company and CPPA for Major Safety Failures and Blackout MismanagementPSCA Seeks Cybercrime Action Against Fake E-Challan SMS ScamADB Warns Critical Water Emergency in PakistanEmirates Denies Boarding to Pakistanis Over False Visa ClaimsTCS ‘Catfishing’ Case: High Court Upholds Fine for Wrong DeliveryReceived a Late Tax Filing SMS? FBR Says Telco Glitch Caused ItIMF Approves $1.29B Tranche for Pakistan: Critical Climate FundingPM announces commencement of 3G/4G services in South Waziristan from today3G and 4G users have increased by 2 million from July to August 2020Total broadband users in Pakistan reach 70 million mark, PTAMore than 56 million Pakistani use 3G/4G networkBalochistan to get better 3G and broadband services, MoITPakistan now has 53 million 3G and 4G subscribers, PTA89% of the population in Pakistan cannot afford internet, IMFBroadband internet users in Pakistan cross 50 millionMore than 47 Million 3G/4G subscribers in Pakistan: PTABasit Anwar3G/4G users in Pakistan reach 46 million, broadband subscribers reach 48 millionUzair KhalidPakistan’s 3G/4G market hits a new high with almost 45 million usersSenate Committee Slams Islamabad ‘Digital Survey App’ Over Privacy RisksFaceTime and Snapchat Hit by New Ban in RussiaIslamabad Traders to Decide Protest Plan Against Mandatory POS on December 10Pakistan Receives $3.2 Billion in Remittances in November 2025Senate Committee Grills NCCIA Over Ducky Bhai Extortion ScandalOnePlus Pad Go 2 Specs Leak Shows 10,050mAh Battery and MediaTek Dimensity 7300-UltraTwo-Month Countdown to 5G Begins: IT Minister Defends Rising Mobile Package RatesAbu Dhabiairsialleaks,Pakistan’s 2025 Corruption Perception Survey By TIP: Key Findings & PM Responsenew limits will roll out in several countries over the coming weeksTrump Oval Office Meeting: The Key to Netflix’s $82.7B Warner Bros VictoryWhatsApp Tests New Feature to Share Recent Chat History with New Group MembersDucky Bhai’s Testimonial: Did ISI, MI Save the Famous YouTuber From NCCIA Extortion?Nova Fliprumours,huawei foldable phoneopen-sourceTenstorrentOpen-source AIThe AI Throne Wobbles as ChatGPT Stalls with Gemini & DeepSeek SurgingGeneration AI: How Smart Toys & Chatbots Are Rewiring ChildhoodPatch 11.08https://t.co/iyw4Oywam0reworkedRiot GamesValorantForget the GTA VI Wait: ‘FV Mods’ Built a Grand Theft Auto Multiverse Inside GTA VResident Evil Requiem Leak Reveals A Surprise Playable CharacterPoppy Playtime Chapter 5 Teaser: The “Living Hair” Villain & Poppy’s Grim FateGTA Online Update: ‘Michael’ Returns & Mansions Arrive This WeekReddit posts,Annural KhalidBilal HafeezWalee.pk and get a free copyCabinet Approves Visa Clearance System to Tackle Fraud and Simplify Travel AbroadDucky Bhai Faces NCCIA Questions Over YouTube Uploads From Restricted Account During Ongoing CasePIA Privatization: Arif Habib Group Wins the Historic Bidding Round With the Largest BidMOITT Announces High-Level Tech Jobs to Strengthen AI, Cybersecurity, and Digital Economy5 Biggest Gaming Disappointments of 2025: When Hype Met RealityBitcoin Slides to $87K: $952M Outflows Clash with Institutional OptimismKP Plans $642 Million Rail Project to Modernize Train ServicesBattlefield 6 Players Accuse EA of Selling AI-Generated CosmeticsKarachi Extends Motor Cab Rickshaw Ban on 25 Major Roads Until February 2026Call of Duty Co-Creator Vince Zampella Dies in California Car Crash at 55ChatGPT Introduces Spotify Wrapped-Style Year End RecapNetflix Expands Gaming with Ready Player Me AcquisitionThree Members Shortlisted for Telecom Tribunal, Cabinet Approval AwaitedArif Habib Welcomes Fauji Fertilizer in PIA Revival PlanLahore Uni Student Death Triggers Alarms Over Study PressurePakistan’s Internet to Double In Speed by June 2026Former Rockstar Director Says GTA 6 Will Be the Most Expensive Game EverApple iPhone Upgrade Call Puts Millions of Devices at RiskNew MacSync Stealer Evades macOS Gatekeeper ProtectionsECC Lays Out The Conditions 5G Spectrum Auction Will Be HeldBest Gaming Laptops in Pakistan 2025: Top Picks for Every Gamer5x Faster AI? “DMS” Breakthrough Crushes Memory BottlenecksEpic Games Store Holiday Giveaway: Claim ‘The Callisto Protocol’ Free TodayBTC to PKR Insight: Bitcoin Stuck Between $85K and $90K Before Year-End ExpiryFBR Cracks Down on Non-Compliant Tax Evaders, Recovers BillionsNo Holiday for Federal Employees on December 26, 2025Prime Minister Orders Major Port Reforms to Speed Up Trade and Cut Business CostsWho Exactly is Arif Habib? Meet the Powerhouse That Just Bought PIAADB Plans Multi-Sector Development Projects in SindhStrict Traffic Action in Gujranwala Leads to Record ChallansPrize Bond Draw Dates & Cities Announced for 2026Public Universities Set to Manage Commerce Colleges in PunjabTikTok Reveals Pakistan’s 2025 Top Searches: From FitnessTok to Viral FoodsKareemabad Underpass Project Nears Completion In KarachiFederal Tax Ombudsman, Bangladesh Revenue Body Expand CollaborationPunjab Government Announces Christmas Bonus for Christian EmployeesGold and Silver Prices in Pakistan Today, 24th December, 2025Pakistan Railways Approves Fresh Hiring to Address Driver Shortage2,251Hyundai is Offering 1.1 Million Off on Its Hybrid Cars/RangePunjab Declares Public Holidays on Dec 25 and 26Pakistan Approves New Solar Billing System, Ends Rs25.98 Net Metering RatePM Laptop Scheme 2025 Rolled Out in Another ProvinceIslamabad Announces Public Holidays on December 25 and 26Maple Leaf Cement to Acquire Pioneer Cement in Big $270.5M DealWhatsApp “GhostPairing”: Hackers Can Hijack Your Account Without a PasswordHogwarts Legacy 2 Job Listings Hint at Competitive Multiplayer & QuidditchDewan Motors Cuts HONRI VE Prices-Save Up to Rs. 600,000NEPRA Solar Consultation Sham: Portals Locked as Policy Change is ForcedThe Graveyard of Pakistani Startups in 2025: What Went Wrong In the Last 5 Years?Here’s A Golden Chance to Win PKR 50,000 For Pakistani StudentsPM Cloud Program: Up to 60% Cost Reimbursement for Pakistani StartupsDevFest Islamabad 2025 Highlights AI Innovation, Digital Literacy, and Pakistan’s Growing Tech EcosystemThese Seven Pakistani Startups Are Heading to CITADEL Davos 2026Pakistan Still Lags Behind An Inclusive, Future-Ready Tech Ecosystem in 2025German Company SAP Bets Big on Pakistan’s Tech Talent as It Expands Cloud and AI FootprintWECON Masawaat 2025 Launches on 26 Nov to Boost Women Entrepreneurs in PakistanHow One Pakistani Startup Aims to Fix Hospital Workflows Utilizing AI123Punjab Driving License Centers Go 24/7 in Major CitiesIslamabad to Launch E-Tags for Motorcycles to Enhance SurveillanceInterest-Free Installments Announced for MG HS LineupPunjab Set to Finalise Electric Taxi Beneficiaries Through E-BallotingMurree Snowfall Prompts Traffic Advisory for TouristsSmuggling Vehicles to Be Seized Permanently Under SC Orders# IslamabadMG Motors Offers Rs. 800,000 Worth of Free Maintenance for HS LineupKarachi Industrial Zones to Receive Rs. 9.28 Billion for Road ProjectsT-Chowk Flyover Inaugurated After Record-Time CompletionIslamabad Learner Permit Rules Tightened Amid ScandalPakistan Auto Loans Rise for 12th Straight MonthSindh Govt Orders Strict Action Against Vehicles Using Fake Fitness CertificatesCabinet Approves Recommendations for 5G Spectrum AuctionFederal Cabinet All Set to Approve 5G Spectrum Auction TodayNCCIA Busts Massive Foreign-Run Ponzi Scheme in Karachi’s DHAMassive Fake DLIMS License Issuance Scam Targets TikTok Users in PakistanIslamabad IT Park Gets New Deadline: 98% Structure ReadyApple’s New iOS 26.2: Here Are All the Major Tools & UpgradesCloudflare Apologizes Again After A Second Major Outage in WeeksOPPO Reno15 FS 5G Arrives in Europe with 50MP Cameras and 6,500 mAh BatteryHuawei Launches Nova 15 Series in China with Dual-Ring Design and Upgraded CamerasOnePlus Turbo Smartphones Appear on Geekbench With Key SpecsXiaomi 17 Ultra Launch Confirmed With Triple Camera Setup and New ColorSnapchat Pushes Deeper Into AI With Custom Lens FeatureLinkedIn Adds Year in Review Feature Focused on User ActivityNo More Social Media Bans: Pakistan Wants Big Tech to Open Local HQsPunjab Announces Class 8 Board ExamsWinter Break Schedule Announced for Colleges in PunjabPunjab Temporary Teachers Unpaid for Two MonthsAI Can Mirror Human Personalities: Why Experts Fear “AI Psychosis” & ManipulationOpenAI Updates Model Spec: Strict New Safety Guardrails for Users Under 18Google Expands Gemini AI Verification Tool to Detect AI-Generated VideosHow to Create a LinkedIn Profile That Actually Gets You HiredGoogle Gemini 3 Flash is Here Challenging GPT-5.2 for AI Market DominanceGoogle Translate Adds Gemini-Powered Live Headphone TranslationAdobe Hit with Class-Action Lawsuit for Using Pirated Books to Train AIGoogle Launches CC AI Agent to Streamline Emails and WorkflowChatGPT Images Is Now 4× Faster with Enhanced Editing & CreativityAI, Deepfakes Emerging Threats as Militants Expand Online TacticsGoogle Translate Gets Gemini AI and Real-Time Headphone Translation FeatureOpenAI Releases GPT-5.2 With A Clear Push in Enterprise AI MarketGoogle Rolls Out Disco, an AI Feature That Converts Browsing Sessions Into Instant Web AppsChatGPT Gets Built-In Adobe Creative Apps Without Design SkillsChatGPT Surpasses Top Social Apps to Become 2025’s Most Downloaded iPhone AppOpenAI Sounds Alarm Over Rising Cyber Threats From Future AI SystemsAI Giants Warned to Fix ‘Delusional’ Chatbots as US States Demand Actiondigital mediaKashmirNarrative WarfareWhy Pakistan’s Chromebook Assembly Push Is A Smarter Bet Than Critics ClaimThe Internet Voted to ‘Delete’ Nintendo, and Here’s a Defence for the DevilPakistan Exchange Rates Update: USD to PKR Rate TodayReligious Leaders Allege SBP Shielded Banks From Interest-Free DeadlineNBP Updates USD to PKR and Other Foreign Exchange RatesFinance Minister Pushes Faster Shift to Digital Banking in Meeting With Ant, EasypaisaIFC Backs Engro Fertilizers With PKR 33.6 Billion Local Currency Financingeasypaisa Hosts Annual Dinner Celebrating 1st Digital Banking Anniversary & Partners in ProgressGold and Silver Prices in Pakistan Today, 22nd December, 2025Gold and Silver Prices in Pakistan Today, 23rd December, 2025Gold and Silver Prices in Pakistan Today, 18th December, 2025SBP, PSEB Introduce Special Banking Desks to Support IT ExportersIMF Warns Pakistan’s Federal Tax Revenues to StagnateTax Proposals Sought Nationwide Ahead of Budget 2026–27Power Division, K-Electric Clash Over Tariff Differential Subsidy Payment BasisUSD to PKR Today: Dollar Holds Firm in Open MarketEconomic Weaknesses Force Pakistan to Seek IMF Relief and ReformsSBP Conducts Large-Scale OMOs, Pumps Rs12.43 Trillion into Financial SystemWorld Bank Approves $700 Million to Strengthen Pakistan’s economyGold and Silver Prices in Pakistan Today, 20th December, 2025Airschool announces tools for experts to teach and make money onlineNational Incubation Center Karachi to begin operations next monthKeepTruckin raises $50 million from Google Ventures and others, expands to Islamabad & LahoreHow to watch the second day of Mark Zuckerberg’s testimony to CongressYayvo announces roadmap for Black Friday celebrations in Pakistanfoodpanda unveils a fresh new look and exciting featuresTechJuice is now accepting nominations for 25 Under 25, 2018[Images] Here is a look at UBL’s new head office in the heart of KarachiInfinix Hot 5 Review: A budget smartphone with killer value for moneyWi-Tribe unveils LTE-Advanced packages delivering 4.5G speeds in PakistanInside the recruitment process of VentureDive, the company that developed Careem’s technology stackHere’s how Superior University is transforming the business industry of PakistanUpcoming
Xiaomi Redmi 15 5GRs. 67,999ZTE nubia Neo 3Rs. 54,999Huawei Nova Y73Rs. 57,999Available
Xiaomi Civi 5 ProRs. 119,999Upcoming
Oppo Reno 15cRs. 134,999Upcoming
Oppo Reno 15 ProRs. 144,999Upcoming
Oppo Reno 15Rs. 114,999Sharks are BACK!!!u/Dev-TechSavvyPakistaniTechSubTel ForumPak women growthWomen barriersWomen online pakApple Turns to Samsung as RAM Prices Surge GloballyMicrosoft Updates Windows to Discourage Google Chrome DownloadsOppo Confirms December 25 Launch Date for Pad Air 5 TabletPakistan Plans Federal CERT as Part of New National Cybersecurity FrameworkGoogle Updates Maps for Faster, Easier Device Tracking With Find HubPakistan Clinches Massive $4 Billion Arms Deal With LibyaDevelopers Hit as Fake WhatsApp API Package Emerges on npmPakistan to Assume DCO Council Presidency in February 2026Google Will Finally Remove Double Tap to Access Wi-Fi Quick SettingsNew Android Malware Can Now Harvest Data From Your Messages & Bank AccountsCyber Threat Group Blind Eagle Launches Sophisticated Malware AttacksAI Chatbots Mimic Human Personality Traits, New Study FindsNVIDIA to Slash GPU Production by 40%: The VRAM Crisis & Rise of “Super” Cards589Amidst gender disparity, these women are re-defining Pakistan’s entrepreneurial landscapeDanish Ali Bhutto8 reasons why Patari Music is an opportunity missed by Telenor and Jazz Digital TeamsNabeel HanifHow this Lahore-based car wash startup increased sales by 60% through influencer marketingAwais ImranWorldCup T20 Cricket – Pakistan Vs India – How Data Science Can Help?Zeeshan ul HassanMy thoughts on Rozee.pk recent brand relaunchAbdus SalamWhat Pakistani ecommerce stores are doing wrong in their online salesMohammed KhananiBuilding Pakistan’s First Hand-Drawn Animation StudioUsman RiazHow to be an Ethical Hacker? Tips to choose the right pathBabar Akhunzada6 ways you can make the most of your time at Business IncubatorsAsma AbbasBytes.pk is giving away 10,000 VR headsets absolutely freeBytes .pkData Sciences, ISIS and Predictions for 2016Dear Startup Ecosystem, let’s have a heart to heartZahid H LilaniWhy nobody will steal your shitty startup ideaDavid Amsthe messagetech talentNCCPL Creates Mobile App For Investor VerificationMuhammad Muneeb Ur RehmanHEC to Showcase Rs 2.9 Billion Technology Development Fund InnovationsResults Declared for National Registration Examination of Foreign Medical GraduatesWho is Arif Habib Limited? Meet the Powerhouse That Just Bought PIAXiaomi Redmi Launches Global Note 15 Pro Duo With Bigger Batteries and Display UpgradesNew Leak Suggests OnePlus 15T Will Be a Rare Compact Performance PhoneiPhone Fold expected to launch in 2026 but ship in 2027Leak Reveals Oppo Find X9 Ultra’s Dual 200MP Camera SetupOnePlus Turbo to Feature the Biggest Battery Ever in a OnePlus PhoneOppo Reno15 Pro Mini Launch Timeline and Key Specs Surface in Fresh LeakMotorola’s Special FIFA Edition Razr Appears in New LeakVivo May Rebrand X200s as X200T, Leaks SuggestGalaxy Z Flip8 Could Be Samsung’s Most Powerful Flip Yet With Exynos 2600Oppo May Launch Reno15 Pro Max Globally After Geekbench ListingHonor Magic V6 Leak Points to Bigger Battery, Wireless Charging, and Upgraded CameraLeak Reveals Key Specs of Samsung Exynos 2600 Chip for Galaxy S26Pakistan’s Mobile Phone Imports Surge 40% in FY26 Despite Local Assembly Push356Digital ageDigital CommunityDigital EconomyPunjab to Distribute 100,000 E-Bikes, Under Youth InitiativeGovt Announces Free AI Training Program, Sets Application DeadlineGovt Plans AI Education Programmes in Europe and China for Pakistani StudentsCareer Opportunities in Punjab: MTRNI Hiring for Multiple Roles12,500 School Teacher Intern Appointment Letters Put on HoldKP Introduces New Subject in School CurriculumFBISE Model to Be Replicated Nationwide for Transparent Exams15,000 Teachers Paid for Exam Duties in LahoreSindh Medical Students Lose Plea for PKR Fee PaymentWinter Break Schedule Confirmed for Islamabad Schools and CollegesIBCC Considers Two New Matric Groups Nationwide, Reviews Equivalence and Study PathwaysBrunei Government Launches 2026 Scholarship Applications for Pakistani StudentsMicrosoft attributedCVE-2021-40444A Hydrogen Jet Engine’s First Test Run:A SuccessPakistani Student Won First Position In Matric Exams of UAEPakistan Has Started A Major Crackdown Against Electricity TheftAfter Bill Gates, CEO Of Nokia To Also Visit Pakistan With Investment PotentialPakistani Ahmed Larik Selected Among Top 100 Saudi Visionary LeadersNASA Helps Farmers By Detecting Plant Viruses In The Crops from AboveChatGPT’s Co-founder Gets The First Ever Indonesian Golden Visa As a ForeignerElon Musk’s Father Claims That Elon Can “Be Assassinated”Bill Gates To Visit Pakistan This Month And Might Invest In Pakistan’s Tech IndustryList of All the Electric Vehicles Options Available For Pakistani Customers29 Scanning Machines And 20 Advanced Walkthrough Gates To Be Installed at Pakistani AirportsHow Demonic Loan Apps Are Cashing On the Failing Economy Of Pakistan23,000 Skilled Workers Have Left Pakistan This Year Including 4,000 EngineersHow India Is Able To Launch The Cheapest Space Missions: A Closer Look at Aditya L-1Bitcoin Holds Momentum Amid Rising Futures Exposure | BTC to PKR UpdatedBTC to PKR Rates & Market Insight: ETFs Hold Firm Amid DowntrendBitcoin Near $87K After BOJ Rate Hike-BTC to PKR UpdatedCrypto Legalization Rumor Sparks Frenzy on Pakistani Reddit ForumGoogle Play Store services to be inaccessible in Pakistan from Dec 1 – 2022Tesla’s Model 3 is now the best-selling electric car in AmericaThe legal spat between OLX and PakWheels will pave way for investments, Industry Experts10 Reasons Why Pakistan is a Great Location for Tech OutsourcingImran AftabHow ecommerce has changed the Pakistani business trendsMuhammad NomanPakistani VAS companies and the dilemma of Digital Transformation5 ways to fight your smartphone addictionHamza KhalidFiberlink: Probably the best internet service provider in PakistanChallenges faced by IT sector of PakistanGoing after Uber and Careem is maybe one of the most mindless things Govt. has done till dateBeyond Black Friday: Why Pakistan needs its own indigenous online shopping festivalAdnan ShaffiUniversity Graduates Even With Top Results Lack Industry Skills and Fail to Get JobsGoogle And TikTok Soon Are Coming To Islamabad- Federal GovernmentHow Can You Learn ‘Anything’ From YouTube For FreePakistan Army Drone Suddenly Crashes In Lahore Near Thokar Niaz Baig5 Free Video Editing Software; Best Free Replacements for Premiere ProMore Than 20,000 People Lost Their Jobs Due To Tech Layoffs This Year6 Tips To Nail Your First Tech InterviewNine Chinese Bank Accounts Frozen For Committing Rs.1.1B ‘Fraud’ In Karachi6 Free Resources To Learn Graphic Design And Earn $$$The US Revealed B-21 Raider Aircraft, A Stealth Bomber That Can Carry Nuclear WeaponsA Fully Loaded Tesla Semi Can Travel 500 Miles On A Single Charge: Elon MuskPIA Privatization Attracts Three Bidders in Live Auction ProcessPIA Privatization on 23 December: Live Auction, Who’s Bidding and What It MeansEpstein Final Secret? Bill Gates & Noam Chomsky Appear in New Photo LeakPakistan International Airlines Privatization Bids Open Live TodayState Bank of Pakistan to Remain Closed on December 25NADRA Introduces Two-Shift System at Karachi Registration CenterSECP Tightens Rules on Issuance of Shares With Different Rights to Protect Minority InvestorsFederal Science Minister Unaware of Policy as Solar Panel Testing Plan Moves ForwardFatima Fertilizer-Linked Globacore Signs JV with Mari Minerals883Medium – TechJuice Wonder App Of The WeekGoogle Keep – TechJuice Wonder App of the WeekSnapseed 2.0 is the Wonder App for Your PicturesArslan AliPeriscope – Wonder App of the WeekOneeb KhanPocket – TechJuice Wonder App of the WeekPaperama – TechJuice Wonder App of the WeekAirDroid – TechJuice Wonder App of the WeekPTA Grants Final NOC for PTCL’s Acquisition of Telenor PakistanTwin Cities’ Educational Institutions Caught in Confusion as Roads Sealed AgainTrump Seals Trade Deal with Pakistan, Slaps Heavy Tariffs on IndiaFBR Exempts Foreign‑Supplied Digital Goods from 5% “Digital Presence” TaxHow A Pakistani Politician’s Son Crashed A $100m Crypto FundPetrol, Diesel Prices Increased in Pakistan from July 16Sparx Smartphones Reportedly Winding Down Operations in PakistanBitcoin Volatile: BTC to PKR Rate Rises Amid Record ETF InflowsHow to Buy Bitcoin in Pakistan? PVARA Chairman Gets Slammed for Giving Bizarre AdviceTRON Founder Justin Sun Explores Pakistani Culture During Islamabad VisitBitcoin Slips Further; BTC to PKR Rate and On-Chain SignalsBitcoin Faces Critical Test Near $82,800 as Year-End Test LoomsBitcoin Holds Near $89,500 Amid Weak Market DemandBinance Collaborates with Fauji Foundation to Drive Blockchain and Crypto Adoption in Pakistan81Russian Company Bury People Alive To Cure Anxiety For Rs.12 MilionVine In Coming Back And The Twitter Blue Tick Price Will Be $8PM Audio Leaks Investigation Panel Hasn’t Gain Any Progress On The CaseMethods To Convert Instagram Leads Via A WhatsApp Link, Learn How?Which phone is the best, iPhone 14 Pro Max or Samsung Galaxy S22?5 Tips to Land a Job in Tech Without Having a DegreeThe Top Movies On Netflix; September 2022Don’t Switch your Android to an iPhone! Here are 5 ReasonsCyber Crimes Are Increasing at an Alarming Rate, Here Are 5 Tips to Protect Yourself Against it7 Smartphones That You Can Buy Under 150k in Pakistan 202211 Important Advice You Need To Take From Warren BuffettThe Best Extensions to Personalise Google Chrome in 20225 Free Website to Learn Free Skills that Will Make You Unstoppablehttps://t.co/MAHIYAzrERMay 5, 2023‘Father Of AI’ Claims That There is Not Stopping Artificial Intelligence ProgressDebunking the myth behind massive job posts and hiring opportunities on LinkedInBreaking Barriers in Technology PhonebloksAll the Buzz in Tech-WorldWhat’s in your bag, Talha Masood?How “Forward Thinking” is the new iPhone 5s?What’s in your bag, Fatima Rizwan?Google Glass and Google Watch7 Things we hate about PhabletsHTC vs Samsung: Why HTC Phones are betterWhy Windows Phone is worth a tryAndroid VS iOS 7HTC One VS Samsung Galaxy S4Microsoft trying to snatch Android UsersWhat’s in your bag, Haris Nadeem?Vacuum of Smartphone Banking in PakistanCan Olaround make it big?Cyanogenmod leaves popular Smartphone Companies behindX Shares the Most Popular Topics and Conversations of 2025YouTube Cracks Down on AI Fiction Channels, Ending the Era of AI-Generated VideosMeta May Start Charging Creators Just For Pasting A LinkTelegram Adds Passkey Logins, Letting Users Ditch Passwords and SMS CodesNew Instagram Rule Restricts Hashtags, Promotes Community EngagementNetflix Deal Wins as Warner Bros Turns Down Paramount Bid… For NowByteDance Agrees to Sell TikTok to U.S. Business Investment PartnersOscars Wants to Livestream Its Award Ceremony on YouTubeInstagram Announces TV App Focused on Reels and Big Screen ViewingNITB Confirms Secure BEEP App Launch for MinistriesMusic, Self-Expression and High Energy Take Center Stage at Spotify’s 2025 Wrapped Event in KarachiYouTube Trials Photo Carousels Inside Shorts for CreatorsPakistan National Assembly Debates Digital Media Bill 2025 Amid Obscenity ConcernsPakistan to Launch BEEP App to Replace WhatsApp for Secure Government Communications185Japan Will Roll out New Traffic Laws In April To Accommodate delivery robots On StreetsTraffic Police in Karachi Will Soon Have Body CamerasInspector General Punjab Police Said That The Use Of Modern Technology Is Vital For Fighting Crime.scarsworseCelebritiescommittedstudyShane KoyczanTo This Day ProjectTo This DayVimeocomicvine.comwas first reportedcalling it a “monstrous war”Russia Adds Meta to ‘Terrorist and Extremist’ Groups Listbeating themNot that Twitter cares@evanalytics pageTwitter CardsSimply MeasuredKloutWhy Pakistan’s 2026 5G Push Could Widen the Digital Divide ForeverECC Approves Advisory Committee Recommendations for Pakistan’s 5G AuctionPTA Unveils Revised IoT Framework for Licensed and Shared SpectrumPakistan’s Telecom Sector Urges Reforms to Accelerate 5G Rollout# Pakistan Telecommunication Authority (PTA)Engro Strengthens Telecom Sector with $475 Million Shariah FinancingPakistan Finance Minister Meets Telecom Tower Firms and VCs on Tax and Growth ChallengesSenate Reviews Privatization Commission Bill 2025 and Power Sector PlansPakistan’s IT and Telecom Exports Ease in November but Post 18% Growth in FY2025-26PTA & MoITT Brief NA Committee on LDI Liabilities & Digital Media RegulationNA Committee Rejects PTA’s Performance Claims Citing Poor ServiceGovernment to Launch 2030 Connectivity Plan & 5G SoonNA Committee Rejects PTA’s “Ridiculous” 99% Satisfaction ReportGlitter-Fest10 handy tools for startups on budgetImage: An example of a Ninja GigKickstarterpersonally respondthere is no update regarding your areafeedbackfreely distributing their albums on USBspay what you want$23.76 millionTED TalkTech Entrepreneurs in Pakistan: Driving Innovation in the Digital AgeDany Wireless Earbuds | Are They the Right Choice for You?Audionic Power Banks | All Hype or a Good Choice?PTA SMS Codes That Every Pakistani Should Know!# android# Windows Phone# Applications# Women in Tech# TED# smartphone buying guide# EverNoteHere’s How Many Public Holidays Pakistanis Will Get in 2025Bill Gates falls out of Top Ten Richest Americans for first time since the 1990s5 times Elon Musk was ruthless to fellow tech entrepreneurs5 types of programmers that you will ever encounterCurvy G6: Here is what we know about LG V30 so far5 Startups that are hiring this week10 types of coworkers you will find at every workplaceHere are the 15 Slack Integrations and Channels you will loveAnsab Majeed5 laptops that you can buy under 50K easily in PakistanThese young women featured in TechJuice 25 under 25 are an inspiration for all11 movies which should be in every technology geek’s watch list!5 Pakistani Must Join Facebook GroupsEatOyeacquired EatOyeMeezan BankNational Assembly Panel Postpones Debate on Heavy Mobile Phone TaxesPiLabsRemoteInterview.iovirtual environmentGoogle For Entrepreneurs for Blackbox ConnectP@sha ICT Awards in 2014APICTA 2014 – Jakarta Indonesiahttps://github.com/remoteinterview/EntrepreneursGoogle Skills platformCountering Terror with TechnologySourceAirlinkLinktreeWhatsApp ChannelGold PriceSilver Pricepic.twitter.com/bwP7vAzCQhOctober 23, 2025AI assistantAlibaba AIAlibaba GroupThe IT CrowdThe Big Bang Theorytop paid actorsMythBustersAdamJaimieLouieLucky LouieLootLo.pkDaraz.pkKamyu.pkSony Power Banklocal Sony Display CenterKhi1Khi25000mAh version1000mAh version20,000 mAhwireless versionsWinter VacationsBinanceChangpeng Zhaoi2iPlan9Code for PakistanStartup Weekend Lahorewinners of FAST SOFTECKhizer BajwaQurat - The AppJuice Staff@q_zafarlatest in-house softwareHuawei Mobiles30 reasons you should have your own startupPeshawar Hackathon ended with great products in hand!8 Simple Ways To Boost Your StartupBest Smartphones of 2013 – Popular ChoiceLEL – A Mother, Daughter Startup preserving art!TownTawks – A revolutionary way of shopping online!@Copilothttps://t.co/GNtBAC8Nh6pic.twitter.com/dZaQ9SmbFG7 things you might not know about Steve Jobs and AppleHow to file a Patent in PakistanQMobile’s Deceptive Marketing Tactics Could Land it in TroubleThe Selfie Dilemma: To Take it or NotTelenor Launches Top Trainee Program for Fresh GraduatesTelenor Announces SIM Verification Procedure for Overseas PakistanisPakistani Startup Wifigen Receives Funding from Silicon Valley InvestorSavaree’s Android App Updated with New Design & Much-Needed FeaturesTelenor Announces Summer Internship Program 2015 for Multiple Departments5 Key Takeaways from founding partner of Etohum Burak Buyukdemir’s Talk at PlanX Demo DayPlanX Demo Day Concludes, Promises to Return ‘Bigger & Better’Foreign Direct Investment in Pakistan Drops 26% Despite October UptickPakistan Becomes First to Launch Digital Foreign Direct Investment InitiativeNovember 2024 Sees 27% Rise in Pakistan’s Foreign Direct InvestmentPTA Report: Telecom Investments and FDI Decline Amid Economic UncertaintyNA passes STZA Act to attract more foreign investment in the tech sectorForeign direct investment to Pakistan down by 30% in eight monthsPakistan’s foreign direct investment drops by 27pcBank IslamiBank Profitvivo V60 Lite 5GV60 LiteNA Standing Committee Reviews Digitalisation & Sustainability of Welfare ProgramsU.S. and Pakistan Partner to Strengthen STEM EducationSky47 Limited Hosts Corporate Leaders Dinner to Advance Pakistan’s Digital Infrastructure AgendaBYD-MMC Leads Climate Action Discussion, Calls for Shift to Clean Mobility to Reduce SmogAI Adoption Reduces Hiring in Pakistan’s IT SectorPakistan IT Exports Hit Record $354 Million in JulyPakistan’s IT Exports See First Dip After 19 MonthsCashless Economy Vision Threatened By New BudgetPakistan’s IT Sector at Risk Under Budget 2025, Says P@SHAExperts Cautions Government Not To Impose More Tax On FreelancersP@SHA-ADB Strategic Alliance to Advance Pakistan’s Digital TransformationP@SHA Seeks Clarity for IT Sector in Next BudgetPakistan’s IT Sector Calls for Decade-Long Extension of Final Tax RegimePakistan’s Call Center Sector Sees 20% Export Growth, Crosses $200 Million in FY 2024-25Pakistan Govt Unveils Rs2.5 Billion Initiative in 2025 to Support Pakistan’s Growing Gaming Sector#PinkMobilePolice#PinkLicensingVan#MaryamNawazSharif#WomenEmpowpic.twitter.com/VIxEao3bD3driving licensePunjab PolicereportedPublic HolidayLG and Dolby Want Your Living Room to Sound Like a CinemaApple Releases watchOS 26.2 With Refined Sleep Score ClassificationsProject RainierClaude AIGoogle Cloudhttps://www.techjuice.pk/wp-content/uploads/2025/10/Quantum_Thin_Update.mp4Quantum computingAI Headphones That Zero In on Your Conversation Win Praise and Raise ExpectationsScientists Say They Are Closer Than Ever to Making Biocomputers, Powered by Human Brain CellsAtlas was leashed openCommentu/Pristine-Elevator198Syracuse UniversityPehla QadamPakistan’s Alarming Position on Global Gender Equality IndexPakistan Declares Indian-Made Tech Devices a National ThreatPM Imran Khan addresses global CEOs at the World Economic ForumThese are the most problematic factors for doing business in PakistanPakistan ranked as one of the worst countries for Education and Skills DevelopmentGlobal Shapers Islamabad organizes a public dialogue session to envision Islamabad in futureTop 5 Wireless Earbuds in Pakistan Under Rs 10,00010 Most Anticipated Games Releasing in 2026: Must Keep an Eye Out For These5 Ways Scammers Stole Your Money in 2025: Here’s How to Stop Them5 Best Bluetooth Speakers for Music Lovers in Pakistan to Buy in 2025# ReviewsBest Smartwatches in Pakistan (2025): Top 5 Brands Offering Premium Features at Accessible Prices5 Best Privacy Browsers That Will Make You Forget Chrome in 20265 Pakistani Esports Moments That Shook the Gaming World in 2025Top 5 Google Doodles of 2025: Cultural Events and Celebrations That Captivated MillionsPakistan’s Audio Wars: How Ronin and Zero Hype Their Way Past Quality IssuesIndia’s Ban on Betting Games Sets Stage for Pakistan to Act: What Can We Do?How Illegal Betting Apps Took Pakistan by StormPerplexity AIRedMonk Releases Latest Programming Language RankingsGamers Eagerly Await June 26 As 5 New Titles Drop On One DayWhatsApp Testing New AI Writer to Craft the Perfect MessageDisney Launches Campaign to Shield Darth Vader from AI MisuseGoogle Hints At Pixel 10 Release, Telephoto Macro InnovationChina Unveils 6nm G100 GPU But Lags Behind GTX 660 TiAutonomous Cars Getting Better At Decision Making: Scientists ClaimCritical Android Flaw Could Trick Users into Malware DownloadsStrait of Hormuz Tensions Plunges Bitcoin Below $99KMuch-Anticipated Fortnite x Squid Game Collab Drops June 278990115multiple reportsdubizzle97MoITT Seeks Third-Party Review for Cashless Economy InitiativeIT Ministry Opens Applications for New PSEB CEO After Abu Bakar’s ExitSaudi Arabia’s GO Telecommunications Launches AI Hub in PakistanSupreme Court Launches E-Office System for Digital JudiciaryNIC Karachi Celebrates 12th Cohort Graduation With 30 New StartupsInternet censorshipNarendra ModiPakistan Set to Launch First-Ever National E-Sports PolicyIgnite Offers Global Platform for Pakistani AI & Big Data StartupsIgnite and TDAP Partner to Boost Pakistan IT ExportsMoITT Taps Global Consulting Giants to Reshape Ignite, PSEB, and NTCSenate Committee Slams Ignite’s Flawed CEO Selection Amid Vote Tie and Regulatory ChaosDigiSkills 3.0 to Train 3 Million Youth Following Ignite ApprovalIgnite CEO Vacancy Stalls Key IT Projects Amid Board InactivityIgnite National Technology Fund’s Website Restored After CyberattackGDP growthFBR Targets Social Media Influencers Over Luxury LifestylesNBP and Commercial Banks Extend Hours on November 29 for Tax CollectionsFBR Crackdowns on Doctors & Beauty Salons to Expand Tax Netreported on LinkedIn postPehla Qadam bootcampGoogle formDevelopersnew programNEPRA’s October 2025 reviewpower divisionProfitUnilever Pakistanpic.twitter.com/KZNyZGrTGDOctober 22, 2025BankingAI modelsai modelsPakistan Steel Mills revival planMaritime AffairsPakistan Steel MillsRs 2 Crore Bribe Claim Puts NCCIA Back in Spotlight Over Quotex, Abu Huraira CaseGovt Move Aims to Boost Export Competitiveness as New SRO Brings Cost ReliefChinese Giants to Invest in Punjab: Multi-Billion-Rupee InvestmentsNIC Peshawar Startup Teleport develops locally manufactured electric bikeTech Camp in Peshawar equips women with digital skillsGoogle Business Group Peshawar set to hold BizFest 2018 conferenceNIC Peshawar is inviting applications for its second cohortCourt Suspends Privatization of Govt Schools in KPPunjab Govt Fines Schools Without Colorful DustbinsSindh Withdraws Promotion of Primary School TeachersPunjab to Hold Board Exams for Grades 5 and 6KP Government Introduces Semester System for Schools Starting This YearPunjab to Introduce Teaching License System, Following Sindh’s ModelDigital SkillsTax Relief Measures for Salaried Class Expected in Budget 2025-26Indian Stock Market Crash Wipes $83 Billion as Conflict Escalates with PakistanSpotify Premium Updates Bring Smarter Controls for UsersIMF Approves $2.1 Billion for Pakistan Despite Indian ObjectionsPCB Domestic Tournaments Postponed Due to Pak-India TensionsG7 Urges Pak-India Dialogue as Cross-Border Tensions EscalateUS Diplomatic Advisory Issued for Pakistan Over Security ConcernsPM Summons NCA Meeting As Operation Bunyan Marsoos BeginsBitcoin approaching $100K as Trump hints at deal with ChinaPunjab Govt confirms closure of educational institutions for multiple daysNCERT warns Pakistanis against sharing sensitive informationBritish Council exam cancelled for Lahore as war clouds darken104107108Profit After Tax (PAT)scheduledHybrid SUVsPHEVsSUV PakistanPunjab TeachersHaval H6SUV marketPort Qasim Gains 9th Spot in World Bank RankingsSenate Standing Committee Exposes Rs. 60 Billion Corruption in Port Qasim Land Deal, Orders Immediate ActionUAE VisaPTCL Showcases Long-Term Digital Infrastructure Vision at Connect 2025TikTok Launches Self-Serve Advertising in Pakistan for Small Businesses# Mobilink Bank# Tecno# Ufone 4G# JazzCash# Digital PakistanZong to Accelerate Pakistan’s Digital Transformation Via Comprehensive AI+ PlanUpgrade Life with TECNO SPARK 40 Pro+: Ultra-Slim Smartphone with AI Features to Simplify Daily TasksPakistan and ADB Sign Two Significant ProgramsSECP Issues Revised ESG Disclosure Guidelines aligned with Pakistan Green TaxonomyTelenor Pakistan Unveils Voice over Wi-Fi (VoWiFi) Services to Revolutionize ConnectivityPakistan to Establish Artificial Intelligence Center at Pakistan Industrial Technical Assistance Centre LahoreTelenor Pakistan Advances Digital Transformation with Strategic Core Cloud Modernization Agreement with HuaweiFormula OneRacing CarsLG Showcases IoT-NTN Technology at 5GAA Conference in ParisYou Can Now Play Netflix Games on PC and Other DevicesLG Will Now Use Its Smartphone Factories To Build Home AppliancesApple Has Struck A Business Deal With Major Companies To Develop An Electric CarLG Shares A List Of Phones Which Will Be Eligible For Android UpdatesLG Promises To Support Users With Updates Despite Of Quitting The Smartphone BusinessLG will no longer manufacture smartphones by the end of July 2021LG develops the world’s smallest Bluetooth moduleLG G8X ThinkQ is not your traditional foldable smartphoneAbuBakarThese are the top 5G smartphones unveiled so farNvidia Tests New Tracking Software Amid Chip Smuggling RumoursAmazon Launches Trainium 3, Promises 4× Faster AI Training and Lower Energy UseQuantum Computing Could Break Bitcoin After 2030, Expert WarnsAs NVIDIA Earnings Propel AI Surge, Musk Predicts Work Will Become OptionalAnthropic, Microsoft and NVIDIA Forge Deep AI Infrastructure AllianceNVIDIA Powers Two New Japanese Supercomputers to Advance AI and Quantum ResearchNokia Embraces NVIDIA’s Rescue Offer in AI-RAN PivotNTDCSAPM on Industries and ProductionFederal Tax OmbudsmanSeized vehiclesSmuggledVehiclesKarachi UniversityPakistan’s Economy Is Now Valued at $411 BillionPakistan’s GDP Growth Rises to 1.73% in Q2 Amid Economic AdjustmentsElon Musk’s net worth is higher than Pakistan’s GDP94% of Pakistanis have no idea what GDP isPakistan’s GDP to grow 1.3% in FY2021: World BankAlibaba-Owned Daraz’s Loss-Making Streak Intensifies Despite Cost-Control EffortsTECNO Announces TECNO Day on Daraz with Unbeatable Prices and Exclusive OffersMobilink Bank Daraz Partnership to Support MSME Financing and Digital AccessSavyour to Discontinue Services as Platform Shutdown Set for March 20, 2025Daraz Pakistan hosts Seller Summit 2022Cainiao Partners with Daraz to Launch Two Smart Distribution Centres in PakistanAlibaba to make its first entry into Pakistan with logistics serviceDaraz reveals its plans for Pakistan in 2022Daraz unveils a brand new look as it moves into its next phase of growthAfter Alipay, British Airways, Deliveroo and Air BnB, Daraz gets a new identity from Design StudioDaraz Set to Offer Exciting Opportunities to Save Big on the Year-End 12.12 SalePM Imran Khan meets CEOs of Daraz and Veon, talks about potential of IT in PakistanCarExperthereUfonegaming in pakistanGaming IndustryPM PakistanPMYPElectricity Bills Set to Rise in Pakistan in 2026NEPRA Approves Minor Hike in October Electricity BillsNEPRA Hints at Further Cut in Electricity PricesAccording to AudiAudiMyAudi AppSenator Blocked from Proposing Bill to Regulate Cryptocurrencies in PakistanGovt considering a reduction in taxes on mobile phonesPossibility of cyber-attack from India, Senate body expresses fearPakistan govt may consider a ban on night packages and reduce the tax on PKR 100 cardCyber Crime Bill passed by National Assemblyr/FortniteLeaksTECNO AI – So Easy: Making Smart Innovation Simple for EveryoneLemFi Launches AI-powered “Send Now, Pay Later” Service, Combining Credit and Remittances for UK ImmigrantsMazik Global Launches AI-Powered Resource Cloud at ITCNTECNO Joins Hands with Alkhidmat Foundation to Support Flood-Affected Families in PakistanA post shared by CEGA Pakistan (@cegaofficialpk)CEGA’s official websiteCEGAMinistry of IT & Telecom (MoITT)flydubai makes First-Ever Landing at Peshawar AirportAnother Major Pak City Gets Direct Flight to DubaiPlayStation Could Pull Back from Releasing Its Big Games on PC3 Must-Play Sony Game Titles That Has the Internet Hold Its BreathRumors Suggest Sony May Be Developing a Less Powerful Handheld Version of the PS6Sony Raises PS5 Prices in Select Regions Amid Global Economic StrainSony Extends PlayStation Plus Memberships by 5 Days After Global OutageTencent Faces Accusations of Copying Sony’s Horizon Series with New Game ‘Light of Motiram’Sony May Be Preparing to Enter the Handheld Gaming Market AgainSony to Launch its Portable PlayStation Portal Later This Year For $199.99Microsoft Signs Agreement to Keep Call of Duty on PlayStationCEQUENSPTCL UfoneFoldable iPhoneMoITT Seeks Lead Consultant for National Digital Services PlatformGovt Restructures NITB In A Bid to Boost Digital Pakistan VisionCabinet Reverses Decision to Dissolve NITBBeep App Completes Testing, Awaiting NTISB Approval for Official LaunchNITB’s Beep App Completes Testing, Set for Deployment to Government EmployeesIT Ministry Seeks Reversal of Decision to Dissolve NITBGovt Extends NITB Director Imran Maqsood’s Contract for One YearPM Orders E-Office Compliance Review as Ministries Resist Digital RolloutIT Ministry to Dissolve NITB as Part of Federal Government’s Restructuring PlanITCN Asia 2023:Digital Domination, Opportunities, And ChallengesIT Ministry to Launch Government Employee Communication App ‘Beep Pakistan’ Next WeekPakistan and UAE Agree to Boost Rail ModernisationDubai Announces Plan to Train Custom Officials in MetaverseEmirates to Soon Launch the World’s First Robotic Airport Check In SystemEmirates set to fly UAE-based Pakistanis from Islamabad to Dubai on 21 MayEmirates resumes passenger flights to 9 destinations, including connections between UK and AustraliaEmirates operates special flights to repatriate Pakistanis from the UAESmall change and Skywards Miles help Emirates make a big difference to people’s livesEmirates SkyCargo scales up operations in Pakistan to transport essential commoditiesEmirates puts customers first in COVID-19 waiver policiesGillette Pakistan LtdProcter & Gamble (P&G)World Bank Approves $400 Million to Modernise 16 Cities in PunjabSBP and IFC Partner to Boost Local Currency FinancingIPPsMagic8Magic8 ProHonor phonesResident Evil Requiem Trailer Confirms the Return of ‘Leon Kennedy’The Last of Us Co-Creator to Reveal First Game in 9 Years at The Game AwardsResident Evil Requiem Producer Debunks ‘Leon Kennedy’ RumoursResident Evil Requiem: Surprising Multiplayer Origins RevealedResident Evil Requiem: Capcom Accidentally Leaks Leon KennedyCapcom to Reveal ‘Resident Evil Requiem’ at June 26 Showcasesenior researcher claimsBSEK to Live Online Scrutiny Portal in Three DaysMay 27, 2024CapcomResident Evil FranchiseIESCO Makes AMI Meters Mandatory for Net Metering, Consumers to Bear CostRawalpindi Gets 1 Million AMI Meters as IESCO Expands Smart Grid InitiativeIslamabad Net Metering Crosses 100MW as Solar Installations GrowRawalpindi installs over 200,000 smart metersIESCO employees now use a mobile app for timely resolution of customer complaintsIsrael-Iran Conflict# OnePlus Phones# xiaomiRealme Neo8 Leak Reveals 8,000 mAh Battery and Snapdragon 8 Gen 531National Cyber Crime Investigation Agency (NCCIA)Income TaxBaseus Unveils World’s First Power Bank With Built-In 4G HotspotGiveaway – PluginTec Core II Power BankAli Shahzad25 tech products that you can buy under $25 on AliexpressSidra AminTesla launches a power bank & it looks stunning just like its carsAWSCybersecurity Advisoryairport securityKarachi AirportPakistan Airports Authority (PAA)Barracuda report27 documented victims across sectorsAI MalwareImportsNTC Foils Two Major Cyber Attacks on Government InstitutionsNew On-Orbit Satellite Launches to Train Against Cyber AttacksGovt Confirms Firewall Installation Amid Internet Slowdown ConcernsHackers target SMBs using AI and productivity tool malwareMassive Data Leak Exposes Login Details of 184 Million NetizensHannibal Stealer Malware uses Military-Grade tactics to Evade DetectionX Faces Major Outage, Musk Attributes It to a CyberattackNew Chrome Extension Attack Poses Threat to Password Managers and Crypto WalletsGoogle Chrome